KEGG   Haloterrigena sp. YPL8: HYG82_05205
Entry
HYG82_05205       CDS       T06745                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
haly  Haloterrigena sp. YPL8
Pathway
haly00053  Ascorbate and aldarate metabolism
haly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    HYG82_05205
Enzymes [BR:haly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     HYG82_05205
SSDB
Motif
Pfam: Epimerase NAD_binding_4 NAD_binding_10 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 GDP_Man_Dehyd DapB_N
Other DBs
NCBI-ProteinID: QLG48287
UniProt: A0A7D5GGF5
LinkDB
Position
1084277..1085083
AA seq 268 aa
MTDIAINGAAGNVGREAVDSFPDDDHELTLFSHSETDDLDATPLEITNSEAFGDALEGQD
VLIHLAANASPRAEWDELRGPNVDGLYNAFEAATAADLERVVFASSNHAVNRKNTVSPIR
PESSVASPAIVRPSDSTDPDTYYGVTKVFGEAMGSYYAKRHGLDVVNLRIGWLLTRDELR
QECQKRDGAGERYARAMWLSPGDCRRVIHAAATATLEESPLIAHGISDNSERFLSLSETM
QALEYRPQDDAEAVLSDESNGHNGLETT
NT seq 807 nt   +upstreamnt  +downstreamnt
atgactgatatcgccatcaacggcgcggcgggaaacgtcggccgggaagccgtcgattcc
tttccggacgacgaccacgaactgacgctattttcccacagcgagaccgacgatctggat
gcgacgccgctcgagattaccaacagcgaggcgttcggcgacgcgctcgagggacaggac
gtattgatccacctcgctgcgaacgcgtcgccgcgagcggagtgggacgaactacgtggg
ccgaacgtcgacggcctctacaacgccttcgaagccgcaaccgcagccgacctcgagcgg
gtggttttcgcgagttcgaaccacgcggtcaacaggaaaaatacggtctcgccgatccga
ccggagtcgtcggtcgccagccccgctatcgtccgaccgtctgattcgacggaccccgat
acctactacggcgtgacgaaggttttcggggaggcgatgggatcgtattacgccaagcgc
cacggactcgacgtggtgaacttgcggatcggctggctgctcactcgagacgaactccgt
caagagtgccagaagcgggatggggcaggcgagcgctacgcacgcgcgatgtggctgagc
cccggcgactgccgccgagtgattcacgcggccgcaacggcaacgctcgaggagtcgccg
ctgatcgcccatggaatttccgataattcggaacggttcctctcgctttccgagaccatg
caggcgctcgagtatcgaccgcaggacgatgcggaagcggtactgagcgacgaatcgaac
ggtcacaacgggctcgaaacgacgtaa

DBGET integrated database retrieval system