Halomicrobium mukohataei JP60: E5139_14550 Help Entry E5139_14550       CDS       T05947                                  Name (GenBank) hypothetical protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism halz  Halomicrobium mukohataei JP60 Pathway halz00280   Valine, leucine and isoleucine degradation halz00630   Glyoxylate and dicarboxylate metabolism halz00640   Propanoate metabolism halz01100   Metabolic pathways halz01110   Biosynthesis of secondary metabolites halz01120   Microbial metabolism in diverse environments halz01200   Carbon metabolism Module halz_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:halz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     E5139_14550    00640 Propanoate metabolism     E5139_14550   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     E5139_14550 Enzymes [BR:halz01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      E5139_14550     6.4.1.3  propionyl-CoA carboxylase      E5139_14550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YukD Motif Other DBs NCBI-ProteinID:  QCD66804 UniProt:  A0A4D6KFF3 LinkDB All DBs Position 2847770..2848105 Genome browser AA seq 111 aa AA seqDB search MSSLEPTDDEEPTDDADETTVTVTAGDRELDVSLPDDASSSEAAAIASAISAHVTDRQRA AAAAAAARDDGPEYANEWVLEGRLERFGKRRRPQRVEKGDEWKAAGRSFYR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcactcgaaccaactgacgacgaggaaccgaccgacgacgccgacgagacgacg gtgaccgtcactgccggcgaccgggaactggacgtgtcgctcccggacgacgcgtcgtcg tccgaggccgcggccatcgcctcggcgatcagtgcccacgtcacggatcgccagcgcgct gcggccgccgcggcagcggcgcgcgacgacggacccgagtacgccaacgagtgggtactc gaagggcgtctcgaacgcttcggcaagcgccgccgtccacagcgcgtcgagaagggcgac gagtggaaggcggccggtcggtcgttctatcggtag

DBGET integrated database retrieval system