Hafnia alvei: AT03_03190 Help Entry AT03_03190        CDS       T03425                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism hav  Hafnia alvei Pathway hav02024   Quorum sensing hav03018   RNA degradation Brite KEGG Orthology (KO) [BR:hav00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AT03_03190 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AT03_03190 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hav03019]     AT03_03190 (hfq)    03036 Chromosome and associated proteins [BR:hav03036]     AT03_03190 (hfq) Messenger RNA biogenesis [BR:hav03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AT03_03190 (hfq) Chromosome and associated proteins [BR:hav03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AT03_03190 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Herpes_capsid Hfq_1 Motif Other DBs NCBI-ProteinID:  AIU71490 UniProt:  A0A097QYD8 LinkDB All DBs Position 684338..684643 Genome browser AA seq 101 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNPGTGGSSNYHGSNQASSPSSQDSDDAE NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccgttcctgaacgcactgcgtcgcgaacgagtc ccagtttcgatctatttggtgaatggtattaagctgcaaggccagattgagtctttcgat cagtttgtcattctgttgaaaaacacagttagccagatggtttataagcacgcaatttct accgttgttccgtctcgtccggtttctcatcatagcaataatccgggaactggcggcagc agcaactaccacggtagcaatcaggcgtcttcaccgtcgtctcaggacagcgatgacgct gaataa

DBGET integrated database retrieval system