KEGG   Helicobacter cetorum MIT 00-7128: HCW_06235
Entry
HCW_06235         CDS       T02032                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00540  Lipopolysaccharide biosynthesis
hce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HCW_06235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hce01005]
    HCW_06235
Lipopolysaccharide biosynthesis proteins [BR:hce01005]
 Lipid A
  HCW_06235
SSDB
Motif
Pfam: BNR_2
Other DBs
NCBI-ProteinID: AFI04507
UniProt: I0ENI8
LinkDB
Position
1344498..1345631
AA seq 377 aa
MEHSRNLLTLKNLAFLLALLSVLTFIINKHQHPNYTFNPNKPLLTHNKPFFSKLDIPKPK
NAPMVHASSLISLPNKTLLVAYFSGTREGAKDVQINANIYNPNTKKWSEAFILLTRETLS
KSAHEYIKKLGNPLLFWHQNKILLFVVGVSMGGWATSKIYQLESPSIHKPFKLVRSLHLS
PFLNLSHLVRTKPLNTDDGGFILPLYHELASQYPLLLKFDFQANPTELFRPNLLHAQLQP
SITPYKKCAIMAFRNHHFSNALMLQTCLSPTKWQSLLPTNLKNLDDSLNLLNLNNTLYLI
HNPDNLSLRRQKLLISQLKNDNTFHTLSVLDKADEVSYPSSLIDNNFIDITYTYNRQTIR
HIRFNLAYLNSLLSLQP
NT seq 1134 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcttttaacacttaaaaatctggcgtttttattagcgctttta
agtgttctaacttttattatcaataaacaccaacaccctaactatacctttaatcctaat
aaacccctacttactcataataagccctttttttcaaaacttgatataccaaagcctaaa
aatgcgcctatggtgcatgcaagctctcttattagcttgcctaataaaacactcttagta
gcatattttagtgggactagagagggggctaaagatgtgcaaatcaacgctaatatctat
aaccctaacactaaaaaatggagcgaggcttttattcttttgactagagaaactctttca
aaaagcgctcatgaatacattaagaaactaggaaatcccctacttttttggcatcaaaat
aaaatcttgctctttgtagtgggagttagcatgggtggatgggcaacttcaaaaatctat
cagcttgaaagcccttctattcacaagccctttaaattagttagaagccttcatttaagc
ccttttttaaatttaagtcatttggtgcgcaccaaacctttaaatactgatgatggcggt
tttatcttacccttataccatgaattagctagtcaatatcccttattgctcaaatttgat
tttcaagctaatcccacagagctttttcgcccaaacctacttcatgcccaacttcagccc
tcaatcacgccttataaaaagtgtgccattatggcttttaggaatcatcatttttcaaat
gctttaatgctacaaacttgtctatcccccaccaaatggcaatctcttttgccaaccaat
ctcaaaaatttagatgattccttaaatttactcaatctcaataacacgctttatttgatt
cataatcccgataacctttctttgcgccgtcaaaaattgcttatctcgcaattaaaaaat
gataacacctttcatactttaagcgttttagacaaagcagatgaagtaagctacccaagc
tcactgattgataataattttattgatattacttatacttataaccgccaaacaattcgc
cacattcgttttaacttagcctatctcaattcccttttaagtttacaaccatga

DBGET integrated database retrieval system