KEGG   Hahella chejuensis: HCH_06026
Entry
HCH_06026         CDS       T00307                                 
Name
(GenBank) Phosphoenolpyruvate synthase/pyruvate phosphate dikinase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
hch  Hahella chejuensis
Pathway
hch00333  Prodigiosin biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HCH_06026
SSDB
Motif
Pfam: PPDK_N PEP-utilizers PEP-utilisers_N
Other DBs
NCBI-ProteinID: ABC32675
UniProt: Q2S9J9
LinkDB
Position
6166841..6169567
AA seq 908 aa
MTYDSHIVEVSGQQNSNAQSLGGKASSLNTLAAAGFPVPRAYCLTVDAYASFLRESGLDQ
WISGLDQQDASAFTQIRQRIEETQLPSSLRQAIIGAYKDIGAERVAVRSSAISEDSEEHS
FAGQYDTYLHVENEETLVDCVKRCWGSFWTERAHAYEGRQDQRRRSSDADAPMQGIAVVI
QAMIDADAAGVLFTADPLNGDPQRTVIESCWGLGEGVVSGQVTTDTFVIDNQKMELLEQT
LREKPLMSTRAENGGVCLRKTAENKIRAPTLNENEALALAGYANAIRSHYGREMDIEWAL
KDGKIWILQARPITVTPTNSDNRLFADADESNSYIRDNALFSRMDTGEIVTGLMTPLGLS
FCRFYQHNVHGPAIKTMGLLDIGDSQHYMGYLQGHVYLNISASAMLLTQCPPTRDALKFT
KRYSTEEVDLNFYTNPYGKAPQGLQYLKSAGYWTLYQVRNLVTAERTVRDMISLRKRETE
RFLKLDLSAMSLGELNAELQRIDRYFLESCAAYMPFFLQSFALYDALAELCEKWLGDTGK
GLQNRIKASLSNLRTIEVTRGVCDLAASVQRSSHLRQLVLETPLEQLAQALQNDDEGARF
WNNDFMAFLRDYGARGRQEFELSIPRWADDPSYLLQVIRMYLTSDVQLESRLEEIDRKRD
DDTRALLSGLPLRIRLLFKFVISTYAKMAERREATRPTYIAQTWFYRKIIVEVMRRLSAE
KVLKMEDLPYIDFNELRDYVAGRKSAQQAFSAELIERNRRSHLLNQRLQEPPMAIVGGHE
PRRETAETTPTDDNQVFQGIGASPGVAMGRARVITDLPRQAEEFQQGEILVARFTDASWT
PLFVLAAGVVADVGSMLSHSSIVSREFGIPAIVNTKTTTRRIRTGDMLYLDGDAGVVRIE
ERKEDASQ
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgacatacgattcgcatattgttgaagtctccggacaacagaactccaacgcgcagagc
ctgggaggcaaagccagctcgctgaatacgctggcggcggcggggttccccgtacccagg
gcgtattgtctgaccgtggacgcttacgcctccttcctgcgcgagtcaggactggaccaa
tggatcagcggtctggatcaacaggacgccagcgcctttacgcaaatccgccagcgtatt
gaggaaacgcaactgccctcctcgttgcgtcaggcgatcatcggcgcgtacaaggacatc
ggggcggaacgcgtcgccgtgcgctcctccgccatcagcgaggacagcgaagaacactcc
tttgcaggccagtacgacacctatctgcatgtagaaaacgaagaaacgctggtggactgc
gtaaagcgctgctgggggtctttctggacagagcgcgcgcacgcttacgaaggccgtcag
gatcaacgccgccgcagcagcgacgccgacgcccccatgcaaggcatcgccgtggtgatt
caggccatgatcgatgcagacgccgccggcgtattgttcaccgccgatcccctgaacggc
gacccgcaacgcacggtgatcgaatcctgttgggggctgggcgaaggcgtcgtatcgggc
caggtgacgaccgacactttcgtcatcgacaatcagaaaatggagctgctggagcaaacc
ctgcgggaaaaaccgctgatgtccacccgcgcggagaacggcggcgtctgcctgcgaaaa
actgcagaaaataaaatccgcgcccccaccctcaacgaaaatgaagctctggccctggcg
ggctacgccaacgccattcgcagtcattatggacgggagatggatattgagtgggcgctg
aaggacggtaagatctggattctgcaggcgcgccccatcaccgtcacgccaaccaacagc
gacaaccggctgtttgcggacgcagatgagagcaacagctacatacgcgataacgcactg
ttctcgcgtatggataccggcgagatcgtcaccggactgatgacgccgctggggctgtcg
ttctgccgcttctaccagcacaacgtacatggccccgcaatcaaaaccatggggttactg
gatatcggcgattctcagcattacatgggatatctgcagggacatgtgtatctcaacatt
tccgcatcagcgatgttgctgacccaatgcccgccaacccgggatgcattgaagttcacc
aaacgttactctacggaggaagtggacctgaacttctacaccaacccctacggcaaagcg
ccgcaaggactgcagtatctcaagagcgcgggctactggacgctgtatcaggtgcgcaat
cttgtgactgcggaacgcaccgtgcgcgacatgatctcattgcgcaagcgagagaccgaa
cgcttcctgaagctggatctcagcgccatgtcgctgggcgagctgaatgcggaactgcaa
cgcatcgaccgctatttcctggaatcctgcgccgcctacatgccgttttttctacagtca
ttcgcactgtatgacgccctcgcggagttatgtgagaagtggctcggcgacactggcaaa
gggttacagaatcgcatcaaagcgtctctcagcaacctgcgcaccatcgaagtgacgcgc
ggcgtctgtgatctggcggcctccgtccaacgttcaagccacttgcgccaactggttctg
gagacgcctttggagcaattggcgcaggcgctgcagaacgacgacgaaggcgcgcgcttc
tggaacaatgatttcatggcgttcctgcgcgactatggcgcccgcgggcgtcaggagttt
gaactcagcataccccgttgggccgacgaccccagttatctgctgcaggtgattcgtatg
tacctgaccagcgacgtgcagttggagtcgcggctggaagagatcgatcgcaaacgggac
gacgacacccgcgccttgctgtccggcctgcccttgcgcattcgtctgttgttcaagttc
gtcatctccacctacgccaaaatggcggagcgacgcgaagccacccggcccacttatatc
gcgcaaacctggttctaccgcaaaatcatcgtcgaagtcatgcgccgcctcagtgcggag
aaagtgctgaaaatggaggacttgccttacatcgacttcaacgagctgcgcgactatgtg
gcgggaagaaaatccgcgcaacaggctttctccgcagaactgattgagcgtaaccgacgc
agtcacttgctgaaccagcgtctgcaggaaccgcccatggcgattgtcggcggacatgaa
ccccgccgggaaaccgcggaaacaacgcccacagatgacaaccaggtgttccagggcatc
ggcgccagtcccggcgtcgccatgggccgcgcccgcgtgatcaccgatctgccgcggcag
gcggaggagtttcagcaaggcgagatactggtggcccgtttcaccgacgcctcctggacg
ccgctgttcgtgctcgccgccggggttgtcgccgacgtggggtcgatgttatcgcacagc
tccatcgtgtcccgggagttcggcatccccgccatcgtcaacaccaaaaccaccactcgc
cgcatccgcaccggagatatgctctatctcgacggagacgcaggcgtcgtacgcatagaa
gaacgcaaggaggacgccagtcagtag

DBGET integrated database retrieval system