KEGG   Hahella chejuensis: HCH_06028
Entry
HCH_06028         CDS       T00307                                 
Name
(GenBank) Ornithine/acetylornithine aminotransferase
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
hch  Hahella chejuensis
Pathway
hch00333  Prodigiosin biosynthesis
hch01100  Metabolic pathways
hch01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hch00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HCH_06028
Enzymes [BR:hch01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     HCH_06028
SSDB
Motif
Pfam: Aminotran_3 Shikimate_DH
Other DBs
NCBI-ProteinID: ABC32678
UniProt: Q2S9J6
LinkDB
Position
6172289..6174829
AA seq 846 aa
MKFGFIGHPTSIGLKRYVKMLDLLDRSSRDLQVGYQRDIWSHRNLVPFVDFGRIQSPAGV
SCEGIVHYLPLTAEEMLSTPRAVQQRIFEGIESLQAQGAQLVGLGGFTSIIGKRGLVTAE
RAGIPVTSGNSLTTYAGYTVLLQTLERLQLDPADAQVAIVGYPGSICLALAKLLLQLGCR
LDLVHRGTADDAQLLEHLPEHWRSRVTLLNSMDAAYERNRLFAAATSSGGVIDVSRLAPG
SIVVDIALPRDAERPPTPRTDVLVLDGGCVTASPATKLGGESMNMSIKQQINGCLAETMV
LALEGRAECFSIGRDLPPEKVLEIGEIAERHGFRAFPLASYGERINIELINGLRRFHHRG
NAQAPGYTPSDLAATEPDSGEARRSQTVQRYRSYINPMLADFLQMQRCDKVFERAEGCTL
TDTDGERFLDMVSGYGCLNLGHNPQVVTEAIQKYVANMGPNFVQYVSLPEETSKLAERLC
AVAPGRFERVFFSNSGTEAVEAALKLAKAASRRSRFVFANNSYHGKTLGALSVTGREKHQ
KHFRPLLPGCTGVPFGDLEALRVELEQGDVCAFIIEPIQGEGGVYLPPDGYLKAAQELCR
RTGTLLIVDEIQTGLGRTGRLFACEWEGVEPDIMVLSKSLSGGLIPIGATLSSAQIWDAA
YASTGRFLLHTSTFGGCNLAGVAGLAALEGVIEQDLPRRAQEMGDYFKAELQQAVQAYPF
IKEVRGRGLMLGIQFNNDFSGAVEACAREFGTRLPGDWHLAYRFFPDEVREHLAAAVGKM
EESLAEMFCMRFVTKLSNDHRILTFVTANSSTVIRIQPPLIISKEEVDHFVKSFATVCEE
MSTFMN
NT seq 2541 nt   +upstreamnt  +downstreamnt
atgaaattcggatttatcggacacccgacctccatcgggctgaaacgctacgtaaaaatg
ctcgacttgctcgaccgcagttcgcgagacctgcaagtgggctatcagcgggacatatgg
agtcatcgtaatctggtgcccttcgtcgatttcggccgtattcagtcccccgcaggagtc
agctgcgaaggcatcgtgcattaccttccgctcaccgcagaggaaatgctgtccaccccc
agggcggtgcaacagcgtatttttgaagggatagagtcgttgcaggcgcagggcgctcag
ctcgtaggcctgggcggctttacctcgattatcggcaagcgcgggctggtgacggcggag
cgcgccggcatccccgtgaccagcggcaactcgctcaccacttacgcgggctacaccgtg
ctgctgcagacgctggagcgtttacagctcgatccggcggatgcgcaggtggcgatagtg
ggttatcccggctccatctgtctggcgctggccaagctgttgctacagctgggctgccgc
ctggatttggttcaccggggcacggcggatgatgcgcaactgctggagcacctgcctgag
cattggcgcagtcgggtcaccttgttaaattccatggacgcggcgtatgagcgcaatcgc
ctgttcgccgccgccacctcgtccggcggcgtaatcgacgtatcccgcctggcgcccggc
tccattgtcgtagacatcgccctgcctcgcgacgcggagcgccctcctacgccccgtact
gacgtactggtgctggacggtggctgcgttaccgcttcgccggcgaccaagctgggcggc
gagtccatgaacatgtccatcaaacagcagatcaacggttgtctggcggaaaccatggtg
ctggctctggagggtcgcgcggagtgcttctccattggtcgcgacctgcccccggaaaaa
gtgctggagataggagaaatcgcagagcgtcatggcttccgcgcctttcctctggcgtcc
tatggcgagcgcatcaacatcgaactgatcaacgggctgcgtcgcttccaccatcgcggt
aacgctcaggcgccaggctataccccatcggatctggcggcgacggagccggattccggc
gaagcgcgacgctcgcaaaccgtgcagcgctaccgcagttatatcaaccccatgctggcg
gatttcctgcaaatgcagcgctgtgacaaagtcttcgaacgcgcggaagggtgcaccctg
actgatacggacggcgagcgttttctcgacatggtgtccggctacggctgcctcaatctg
ggccataacccgcaagtggtgacggaggcgatccagaagtacgtcgccaacatggggccc
aacttcgtgcaatacgtttccctgccggaagagacctccaagctggcggagcggctctgc
gcggtggcgccgggacgcttcgaacgggttttcttcagcaactccggcacggaagccgtg
gaggcggcgctgaaactggcgaaagcggccagccgtcgctcccgttttgtcttcgccaat
aacagttatcacggcaagacactgggcgcgctctccgtcaccggtcgcgaaaagcatcag
aagcatttccgccccctgctgccgggttgcacgggcgtgccgttcggcgacctggaggcg
ctgcgcgttgagctggaacaaggcgacgtgtgcgcattcatcattgagccgatccaggga
gaaggcggcgtctatctaccgccggacggctatctgaaggctgcacaggaactgtgtcgg
cgcaccggaaccctgctgatcgtggacgaaatccagactggcctggggcgcactggacgc
ctgttcgcctgcgaatgggaaggagtggagcctgacattatggtgttgtcgaaatccctg
tccggcgggctcattcccatcggcgcaacgctcagttccgcgcagatctgggacgcagcc
tacgcctccaccggacgcttcctgttgcatacctccaccttcggcggctgcaacttggcc
ggcgtcgccgggctcgccgcgctggaaggcgtaatagagcaggatctgccgcgccgtgcg
caagagatgggcgactatttcaaagccgaactgcagcaagcggtgcaagcctaccccttt
atcaaggaggtgcgcggtcgtggcctgatgttgggcattcagttcaacaacgacttcagc
ggcgccgtggaagcctgcgcccgggagttcggcacgcgtttgccgggagactggcatctg
gcgtaccgctttttccctgacgaagtgcgcgagcacttggcggcggcggtgggcaagatg
gaggaatcactggcggaaatgttctgcatgcgcttcgtcaccaagctcagtaacgatcac
cgcattctgactttcgtcaccgccaacagctcaaccgtgatacgtatccaacccccgctg
atcatcagtaaagaggaggtcgaccacttcgtgaaatccttcgccaccgtatgcgaagaa
atgtccacttttatgaactaa

DBGET integrated database retrieval system