KEGG   Haloterrigena daqingensis: BB347_08300
Entry
BB347_08300       CDS       T04679                                 

Definition
(GenBank) epimerase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
hda  Haloterrigena daqingensis
Pathway
hda00053  Ascorbate and aldarate metabolism
hda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BB347_08300
Enzymes [BR:hda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     BB347_08300
SSDB
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind DapB_N GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: APX96616
UniProt: A0A1N7BVH4
LinkDB
Position
complement(1696614..1697387)
AA seq 257 aa
MTTIAITGASGRVGRETIEAFEDTDVELSLFSHSESEDLETTPIDVANREAFVGALEDED
VLIHLAANPDPRAEWDALSGPNIEGVYNAFEAAVQNDVQRVVFASSNHAVNMQNTVSSVR
PESTVGSPRTVRPAEAMDPDTYYGVTKVFGEAMGHYYANRHGLDVINLRIGWLLSTDELE
DELADRDASGERYARAMWLSPGDCQRLMDAAATTTLESSPLTAHGISNNAERFLSLTETM
LELNYRPQDDSADVLED
NT seq 774 nt   +upstreamnt  +downstreamnt
atgacgactatcgccatcactggtgcatcaggtcgggtcggccgagagaccatcgaagcc
ttcgaagacacggacgtcgaactcagcctgttttcacacagcgaaagtgaagacctcgag
acgacgccgatcgacgtcgcgaaccgcgaggcgttcgtcggcgcgctcgaggacgaggac
gtgttgatccacctcgcggcgaatccggatccgcgggccgagtgggacgcactctccggg
ccgaacatcgagggagtctacaacgccttcgaagctgccgtccagaacgacgtccagcga
gtcgtcttcgcgagttcaaaccacgcggtgaacatgcagaacacggtgtcgtccgtccgt
ccggagtccaccgtgggttcgccacgaaccgtccgcccagcggaggcgatggaccccgac
acgtactacggcgtcacgaaggtcttcggcgaggcgatgggccactactacgcgaaccgc
cacggactcgacgtgatcaacctgcgaatcggctggttgctctctacggacgaactcgag
gacgaactcgccgaccgggacgcctcgggcgaacgctacgcgcgagcgatgtggctcagc
cccggcgactgccagcggctgatggacgccgcagcgacgacgaccctcgagtcctcgccg
ctgaccgcacacggaatctcgaacaacgccgagcggttcctctcgctgacggagacgatg
ctcgagttgaactatcgaccgcaggacgactcggcggacgttctcgaggactga

DBGET integrated database retrieval system