KEGG   Helicobacter pylori BM012A: U063_0885
Entry
U063_0885         CDS       T02939                                 
Name
(GenBank) neuraminidase (sialidase)
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
heb  Helicobacter pylori BM012A
Pathway
heb00540  Lipopolysaccharide biosynthesis
heb01100  Metabolic pathways
Module
heb_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:heb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    U063_0885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:heb01005]
    U063_0885
Lipopolysaccharide biosynthesis proteins [BR:heb01005]
 Lipid A
  U063_0885
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AHA88231
LinkDB
Position
complement(886007..887125)
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIIMTHQTPPYAFARNQTLSTESPPYFTQLTIPKPDDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVNMGGWATSKIYQLESALEPIRFKFVRKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYSLLLKFDKQNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDLSLRRKELLLSKLENSNSFKTLKILDKADEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgacgcaccaaacccctccctatgcttttgcgcgcaatcaaacc
ctttcaactgaaagccccccctatttcacacaactcactatccctaaaccagatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataacctcttgagcgcttat
tttagcggcactaaagaaggggcaagagatgtgaaaatcagcgcgaatctttttgacagc
aagattaatcgctggagcgaagccttcattattttaaccaaagaagagctttctcattat
tcgcatgaatatatcaaaaaactaggtaaccccttactttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgaacatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgtgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcgggtttatg
ctgccactctatcacgaattagccacccaatactccttgttgttgaaatttgacaaacaa
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagattgcgccatcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccctaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgatttatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaagattttagataaagcggatgaagtgagttacccaagctatagt
cttaatcctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system