KEGG   Helicobacter pylori F16: HPF16_0779
Entry
HPF16_0779        CDS       T01910                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hef  Helicobacter pylori F16
Pathway
hef00540  Lipopolysaccharide biosynthesis
hef01100  Metabolic pathways
Module
hef_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hef00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPF16_0779
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hef01005]
    HPF16_0779
Lipopolysaccharide biosynthesis proteins [BR:hef01005]
 Lipid A
  HPF16_0779
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: BAJ55376
UniProt: E6NE16
LinkDB
Position
807378..808496
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLLLMIMKRQTPPYAFLHNQTLSTESPLYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDNKINRWSEAFIILTKEELSFY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttacttttaatgataatgaagcgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccgagagccccctctatttcactcagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttacctaacgataaccttttaagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacaac
aagatcaatcgctggagcgaagccttcattattttaaccaaagaagagctttctttttat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctaccaactt
gaaagcgctttagagccgattcgttttaagtttgcgcgaaaactctccttaagccctttt
ttaaacttaagccatttgataaaaaataaacctttaaacaccactgatggcgggtttatg
ctaccactctatcacgaattagccacccaataccccttgttgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagactgcgccatcatggcgtttagaaaccattctttaaaagatagtctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcgaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtttatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system