KEGG   Helicobacter pylori Rif2: C730_02995
Entry
C730_02995        CDS       T02318                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hei  Helicobacter pylori Rif2
Pathway
hei00540  Lipopolysaccharide biosynthesis
hei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hei00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    C730_02995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hei01005]
    C730_02995
Lipopolysaccharide biosynthesis proteins [BR:hei01005]
 Lipid A
  C730_02995
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFV44985
LinkDB
Position
complement(610913..612031)
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFMRNQTLVTQTPPYFTQLTIPKPNDA
LSVHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLIRNKPLSTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDSSLRRKELWLSKLENSNSFKTLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaatcataatgaagcgccaaacccccccctatgcttttatgcgcaatcaaacc
cttgttactcaaacccccccctatttcacacaactcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagctctttaatcagcttgcctaacgacaatcttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagtgcaaatctttttgacagc
aaaactaatcgctggagcgaagccttcattattttaaccaaagaagagctttctcattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgcgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataagaaataagcctttaagcaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataacccacgagagcttttaaggcctaatgccctaaaccaccagctccaaccaagccta
accccctttaaagattgcgctattatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaggaactctggctttctaaattagaaaactccaac
tcttttaaaaccttaaaagttttagataaagcgaatgaagtgagttacccaagctatagc
cttaatcctcattttatagatattgtctatacttataaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaaatccctcctcaagtga

DBGET integrated database retrieval system