Halomonas elongata: HELO_3364 Help Entry HELO_3364         CDS       T01311                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism hel  Halomonas elongata Pathway hel02024   Quorum sensing hel03018   RNA degradation Brite KEGG Orthology (KO) [BR:hel00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HELO_3364 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HELO_3364 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hel03019]     HELO_3364 (hfq)    03036 Chromosome and associated proteins [BR:hel03036]     HELO_3364 (hfq) Messenger RNA biogenesis [BR:hel03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HELO_3364 (hfq) Chromosome and associated proteins [BR:hel03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HELO_3364 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  CBV43248 UniProt:  E1V678 LinkDB All DBs Position complement(2791230..2791481) Genome browser AA seq 83 aa AA seqDB search MSKGQSLQDPYLNVLRKERIPVSIFLVNGIKLQGQIESFDQFVILLRNTVSQMVYKHAIS TVVPSRNVRLPASDVSEQSDSNA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtccaaaggacagtcccttcaagatccatacctgaacgtactgcgcaaggagcgcatt ccggtgtcgatcttcctggtcaacggcatcaagctgcagggccagatcgagtccttcgac cagttcgtcatcctgctgcgcaacacggtcagccagatggtctacaagcatgccatctcc acggtggtgccgtcgcgtaacgtgcgcctgccggcgagcgacgtgtccgagcagtcggat agcaacgcgtga

DBGET integrated database retrieval system