KEGG   Helicobacter pylori UM298: K748_00105
Entry
K748_00105        CDS       T02757                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hem  Helicobacter pylori UM298
Pathway
hem00540  Lipopolysaccharide biosynthesis
hem01100  Metabolic pathways
Module
hem_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hem00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    K748_00105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hem01005]
    K748_00105
Lipopolysaccharide biosynthesis proteins [BR:hem01005]
 Lipid A
  K748_00105
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AGR61973
LinkDB
Position
complement(1353014..1354132)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKRQTPPYAFLHNQTLSTKSPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFVILTKEELSYY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVRKLSLSPF
LNLSHLIKNKPLSTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNYQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaatgataatgaagcgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccaaaagccccccctatttcactcaactcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcgttattttaaccaaagaagagctttcttattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgttgtgggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagtgctttagagccgattcattttaaatttgtgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaagcaccactgatggcgggtttatg
ctaccgctttatcacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaactaccagctccagccaagtcta
accccctttaaagactgtgccatcatggcgtttagaaaccattctttcaaagatagtctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagttatagt
cttaattctcattttatagatattgtttatacctacaaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system