KEGG   Helicobacter pylori SNT49: HPSNT_02980
Entry
HPSNT_02980       CDS       T01916                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hen  Helicobacter pylori SNT49
Pathway
hen00540  Lipopolysaccharide biosynthesis
hen01100  Metabolic pathways
Module
hen_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hen00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSNT_02980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hen01005]
    HPSNT_02980
Lipopolysaccharide biosynthesis proteins [BR:hen01005]
 Lipid A
  HPSNT_02980
SSDB
Motif
Pfam: BNR_2 DUF3741 OppC_N
Other DBs
NCBI-ProteinID: AEN16755
UniProt: G2ME74
LinkDB
Position
complement(602272..603390)
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIIMTHQTPPYAFTHNQTLVTQNPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDGKTNRWSEAFILLTREDLSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLIKNNPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTIWQKPMLTNLKNLNDALNLINLNKELYLIHN
SSDSSLRRKELLLSKLENPNSFKTLKILDKADEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKTLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgacgcatcaaacccccccctatgctttcacgcacaatcaaacc
cttgttactcaaaaccccccctatttcacacaactcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataatcttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgatggc
aagactaatcgctggagcgaagccttcattcttttaaccagagaagatctttctcattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctaccaactt
gagagcgctttagagccgattcgttttaaatttgcgcgaaaactctccttaagccctttt
ttaaacttaagccatttgataaaaaataatcctttaaacaccactgatggcgggtttatg
ctaccactctatcatgaattagccacccaataccccttgttattgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagattgcgctattatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccactatttggcaaaaacccatgctgacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
tctagcgattcatcactgcgccgtaaagaactcttgctttctaaattagaaaacccaaac
tcttttaaaaccttaaaaattttagataaagcggatgaagtgagttacccaagctatagt
cttaaccctcatttcatagatattgtctatacctacaaccgctcccatatcaaacacatc
cgttttaatatggcttatttaaaaacccttctcaagtga

DBGET integrated database retrieval system