KEGG   Helicobacter pylori Puno120: HPPN120_02855
Entry
HPPN120_02855     CDS       T01919                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00540  Lipopolysaccharide biosynthesis
hep01100  Metabolic pathways
Module
hep_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPPN120_02855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hep01005]
    HPPN120_02855
Lipopolysaccharide biosynthesis proteins [BR:hep01005]
 Lipid A
  HPPN120_02855
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AEN15194
UniProt: G2M3G0
LinkDB
Position
complement(565056..566174)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFMHNQTLSTKNPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFIILTKEELSFY
SHEYIKKLGNPLLFLHGDKILLFVVGVSMGGWATSKIYQLESALEPIQFKFVQKLSLSPF
LNLSHLIRNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSLKDNLMLETCKTPTSWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDLSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaatcataatgaagcgccaaacccccccctatgcttttatgcacaatcaaacc
ctttcaaccaaaaaccccccctatttcacacaactcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagctttcattattttaaccaaagaagagctttctttttat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatggcgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcggttgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcaatttaagtttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaggaataagcctttaaacaccactgatggcgggttcatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagactgtgctgtcatggcgtttagaaaccattctttaaaagataacctc
atgctagaaacctgtaaaacccccacctcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgattcacaac
cctagcgatttatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatattaaacatatt
cgttttaatatggcctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system