Helicobacter pylori F32: HPF32_0535 Help Entry HPF32_0535        CDS       T01911                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism heq  Helicobacter pylori F32 Pathway heq01100   Metabolic pathways heq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:heq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPF32_0535 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPF32_0535 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAJ58117 LinkDB All DBs Position complement(580480..580716) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system