KEGG   Helicobacter pylori F32: HPF32_0555
Entry
HPF32_0555        CDS       T01911                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
heq  Helicobacter pylori F32
Pathway
heq00540  Lipopolysaccharide biosynthesis
heq01100  Metabolic pathways
Module
heq_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:heq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPF32_0555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:heq01005]
    HPF32_0555
Lipopolysaccharide biosynthesis proteins [BR:heq01005]
 Lipid A
  HPF32_0555
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: BAJ58137
UniProt: E6NP61
LinkDB
Position
complement(597299..598417)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKRQTPPYAFLHNQTLSTESPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLIKNNPLNTTDGGFMLPLYHELATQYPLLLKFDKQNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDLSLRRKELLLSKLENPNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgcctttttcgtggggctttttatcgtt
ttatttttaatgataatgaagcgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccgagagccccccctatttcactcagctcaccatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttaagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcattattttaaccaaagaagagctttctcattat
tcgcatgaatatatcaaaaaactaggcaatcccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgcacgaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataatcctttaaacaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgacaaacaa
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccaaccaagccta
accccctttaaagattgcgctatcatggcgtttagaaaccattcttttaaagatagtctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgatttatctttgcgtcgtaaagaactcctgctttctaaattagaaaacccaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaactctcattttatagatattgtctatacctacaaccgctctcatatcaaacatatc
cgttttaatatggcctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system