KEGG   Helicobacter pylori Rif1: C695_08125
Entry
C695_08125        CDS       T02317                                 
Name
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
her  Helicobacter pylori Rif1
Pathway
her00550  Peptidoglycan biosynthesis
her01100  Metabolic pathways
her01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:her00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C695_08125
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C695_08125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:her01011]
    C695_08125
Enzymes [BR:her01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C695_08125
Peptidoglycan biosynthesis and degradation proteins [BR:her01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   C695_08125
SSDB
Motif
Pfam: Transpeptidase PBP_dimer DUF4709
Other DBs
NCBI-ProteinID: AFV44385
LinkDB
Position
complement(1647284..1649050)
AA seq 588 aa
MKNLRYKLLLFVFIGFWGLLALNLFILSVKNQEYYEKLAERNMTKKEFLVPTRGNITDRN
DEFLATNELVFGVFLPSGLKQKDLLEKIEIIQKFFPNFSKETLLNNYQKENSLYNHNLIK
VVGFIPYATMQPLYAKLIQTQGIFALPLDKRYYPNNALASHVLGYVGVASLQDLKDDEEN
QYSQIVGKTGIEKEYNKLLQGKVGYKIMRVNALNQELATLEVVLPSTNNHLQLSLDKRLQ
KEADKLFENKRGAILVMDAENGELLVAGSYPEYNLNDFVGGISQDKWQKLQDDIYNPLLN
RFANALYPPGSVVKMGVGLSFLENLHITENTTIPTPPFIEVGKHKFRDWKKTGHGNSNLY
KAIRESVDVYFYKFGLEISIEKLSKTLREVGFGEKTGVDLPNEFVGIVPDNLWKLKRFNQ
DWRVGDTLITAIGQGSFLATPLQVLAYTGLIATGKLATPHFAINNKQPLKDPLNSFQKKK
LQALRVGMYEVCNHKDGTAYHSTRGSKITLACKTGTAQVVEIAQNIVNRMKEKDMEYFHR
SHAWITAFLPYEKPKYAITILVEHGEGGSKLGGLLVKMSNKLYELGYL
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgaaaaatcttcgctataagcttttgctctttgtttttatagggttttgggggttacta
gccttaaatttatttattttaagcgttaaaaatcaagaatactatgaaaaattggctgaa
cgaaacatgactaaaaaggaatttctagtccctacaaggggaaatattacagacagaaat
gatgagtttttggccactaatgaattggtgtttggcgtgtttttgcccagcggactgaaa
caaaaagatcttttagaaaaaattgaaatcatccaaaagtttttccctaacttttctaaa
gaaacgcttttaaacaattaccaaaaagaaaattcgctttataaccataacctcattaaa
gtggttggcttcattccttatgccaccatgcaacctctttatgccaaactcatccaaact
caaggcatttttgcgcttcccttagacaagcgttactaccctaataacgctttagcttcg
catgttttaggctatgtgggggtggcaagcttgcaagatttaaaagacgatgaggagaat
caatacagccagattgtaggcaaaaccggcattgaaaaagaatacaacaagcttttacaa
ggcaaggtgggttataaaatcatgcgtgtcaatgcgctcaatcaagaattagccacctta
gaagtagtgctgccaagcaccaacaaccacttgcaattgagtttagacaaacgcttgcaa
aaagaagcggacaagctctttgaaaataaaaggggggctattttagtgatggatgcagaa
aatggggaattgctcgttgcaggaagttaccctgaatacaatttgaacgattttgtaggc
gggatcagtcaagacaaatggcaaaaacttcaagatgatatttataaccccttattaaac
cgcttcgctaacgccttgtatccgccgggatctgtggttaaaatgggcgtgggcttgagc
tttttagaaaaccttcatatcacagaaaacaccaccatacccaccccgccttttattgaa
gtgggcaagcacaaattcagagactggaaaaaaacagggcatggcaattctaatttgtat
aaagccattagggagtccgtggatgtgtatttttataagtttgggcttgaaatctctata
gaaaaactctctaaaaccttaagggaagtgggctttggggaaaaaacgggcgttgatttg
ccgaatgaatttgtggggattgtgccggataatttgtggaaactcaaacgcttcaatcaa
gactggcgcgttggggacacgctcattaccgctattgggcaaggctcttttttagccacg
cccttgcaggttctagcctacacgggactcattgctacgggcaaactggcaacgcctcat
ttcgctatcaacaacaaacaaccgcttaaagatcccctaaatagctttcaaaaaaagaag
ctccaagccttgagagtgggcatgtatgaagtgtgtaaccataaagacggcaccgcttat
cattccacaaggggttctaagattactttagcgtgtaaaaccggcaccgcacaagtcgtg
gaaatcgctcaaaacatcgtcaatcgcatgaaagaaaaggatatggaatatttccatcga
tcccatgcgtggattaccgcatttttgccttatgaaaaacccaaatacgctatcactatt
ttagtagaacatggggaaggggggtcaaaactagggggcctgttagtgaagatgagtaat
aaactctatgagcttggctatctttaa

DBGET integrated database retrieval system