Heterocephalus glaber (naked mole-rat): 101703645 Help Entry 101703645         CDS       T02812                                  Symbol Ghrh Name (RefSeq) growth hormone releasing hormone   KO K05260   growth hormone-releasing hormone Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04080   Neuroactive ligand-receptor interaction hgl04081   Hormone signaling hgl04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101703645 (Ghrh)    04081 Hormone signaling     101703645 (Ghrh)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     101703645 (Ghrh)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101703645 (Ghrh) Cytokines and neuropeptides [BR:hgl04052]  Neuropeptides   GPCR binding    101703645 (Ghrh) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 DUF2290 Motif Other DBs NCBI-GeneID:  101703645 NCBI-ProteinID:  XP_004875583 UniProt:  A0AAX6SFV8 LinkDB All DBs Position Un AA seq 103 aa AA seqDB search MPLWVFFFVILTLSSSSHCSSPVSLPLRMRRYADAIFTNSYRKVLSQLSARKLLQDIMNR QQGKRNQEQGARIRLGRQLDSMWTDQNQVALESMLVALLQKHR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgccactctgggtgttcttcttcgtgatcctcaccctcagcagcagctcccactgctcc tcacctgtctccctgcccctcaggatgcggcggtacgcagatgccatcttcaccaacagc taccggaaggtgttgagccagctgtctgcccgcaagctgctccaggacatcatgaaccgg cagcagggaaagaggaaccaggagcaaggagcaaggatacggcttggccgtcagctggac agcatgtggacagaccaaaaccaggtagcattggaaagcatgctggtggccctgctgcag aagcacaggtag

DBGET integrated database retrieval system