KEGG   Heterocephalus glaber (naked mole-rat): 101716110
Entry
101716110         CDS       T02812                                 
Symbol
Mrap
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
hgl  Heterocephalus glaber (naked mole-rat)
Pathway
hgl04927  Cortisol synthesis and secretion
hgl04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101716110 (Mrap)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101716110 (Mrap)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4 RCR EVC2_like
Other DBs
NCBI-GeneID: 101716110
NCBI-ProteinID: XP_004842339
UniProt: G5BEA0
LinkDB
Position
Un
AA seq 111 aa
MTNRTNTSAPYYSYEYYLDYLDLIPVDEKKLKANKYSIVIAFWVSLAVFVMFLFLILLYM
SWSGSSQMRNGLQHQPQCPWSPGLNLPLCLRSTSPRTADDLGSGTGAHPRL
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaccaacaggaccaacacatccgctccgtactacagctatgaatactacttggactac
ctggacctcattcccgtggatgaaaagaagctgaaagccaacaaatattccattgtgatt
gccttttgggtgagcctggctgtgtttgtgatgttcctcttcctcattctgctctacatg
tcctggtccggttcctcacagatgaggaacggcctccagcaccagccacagtgcccgtgg
agcccgggcctcaacctgcccctctgcctgcggagcacctccccgcggacggcggacgac
ctgggcagcggcactggcgcacacccgcggctctag

DBGET integrated database retrieval system