Heterocephalus glaber (naked mole-rat): 101717405 Help Entry 101717405         CDS       T02812                                  Symbol Sec61b Name (RefSeq) Sec61 translocon beta subunit   KO K09481   protein transport protein SEC61 subunit beta Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl03060   Protein export hgl04141   Protein processing in endoplasmic reticulum hgl04145   Phagosome Brite KEGG Orthology (KO) [BR:hgl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     101717405 (Sec61b)    04141 Protein processing in endoplasmic reticulum     101717405 (Sec61b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     101717405 (Sec61b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101717405 (Sec61b)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:hgl02044]     101717405 (Sec61b) Membrane trafficking [BR:hgl04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     101717405 (Sec61b) Secretion system [BR:hgl02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    101717405 (Sec61b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  101717405 NCBI-ProteinID:  XP_004864996 UniProt:  A0A0P6J9L9 LinkDB All DBs Position Un AA seq 96 aa AA seqDB search MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcctggtccgactcccagtggcactaacgtgggctcctcggggcgttctcccagcaaa gcagttgccgcccgggcagcaggatccactgtccggcaaaggaaaaatgccagctgtgga acaagaagcgcgggccgcacaacctcagcaggtactgggggcatgtggcgattttacaca gaagattcaccggggctcaaagttggccctgttccagtattggtcatgagtcttctgttc atcgcttctgtatttatgttgcacatttggggcaagtacactcgttcgtag

DBGET integrated database retrieval system