Heterocephalus glaber (naked mole-rat): 101721307 Help Entry 101721307         CDS       T02812                                  Symbol Myl7 Name (RefSeq) myosin light chain 7   KO K12754   myosin regulatory light chain 7 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04510   Focal adhesion hgl04520   Adherens junction hgl04670   Leukocyte transendothelial migration hgl04810   Regulation of actin cytoskeleton hgl04814   Motor proteins hgl04820   Cytoskeleton in muscle cells hgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hgl00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     101721307 (Myl7)    04520 Adherens junction     101721307 (Myl7)   09142 Cell motility    04814 Motor proteins     101721307 (Myl7)    04820 Cytoskeleton in muscle cells     101721307 (Myl7)    04810 Regulation of actin cytoskeleton     101721307 (Myl7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101721307 (Myl7)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101721307 (Myl7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hgl04812]     101721307 (Myl7) Cytoskeleton proteins [BR:hgl04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      101721307 (Myl7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C EF-hand_9 CHCH SAPC2_N Motif Other DBs NCBI-GeneID:  101721307 NCBI-ProteinID:  XP_004839981 UniProt:  A0AAX6NYS9 LinkDB All DBs Position Un AA seq 174 aa AA seqDB search MASRKAGMRGKAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRETY SQLGKVSIPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGV VNKDEFKQLLLTQADKFSPAEVEQLFALTPVDLAGNIDYKSLCYIITHGDEKEE NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaaggccgggatgcggggcaaggccgccaccaagcaggcccagcgtggg tcttccaatgtcttctccatgttcgagcaagcccagatccaggagttcaaagaggccttc agctgcattgaccagaaccgggacggtatcatctgcaaatcggacctgagggagacctac tcccagcttgggaaggtgagcatcccagaggaggagctggatgccatgctgcaggaaggg aaaggccccatcaacttcaccgtcttcctcaccctcttcggggagaagctcaatgggaca gaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagtggccagggggtg gtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaagttctctcctgct gaggtggagcagctgttcgccctgacacccgtggatctggcaggcaacatcgactacaag tccctgtgctacatcatcacccacggagatgagaaggaggagtag

DBGET integrated database retrieval system