KEGG   Halyomorpha halys (brown marmorated stink bug): 106686814
Entry
106686814         CDS       T07536                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
hhal  Halyomorpha halys (brown marmorated stink bug)
Pathway
hhal00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:hhal00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106686814
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hhal00199]
    106686814
Enzymes [BR:hhal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106686814
Cytochrome P450 [BR:hhal00199]
 Cytochrome P450, animal type
  CYP306 family
   106686814
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 106686814
NCBI-ProteinID: XP_014285842
LinkDB
Position
Unknown
AA seq 540 aa
MSMSLGVLSCFSSSVSFDYIMELLEEIGKLIVNYVSSNILLCLNYFINGLENFNLEDLSE
MLIASIVLLCATVFFYYMWRTRGMPPGPWGLPLVGYLPWIDKKKPYLSLMELYQDYGGIC
TIRLGEVVAIVVSEPHYVKEALSQEVLTGRAPLWLTHGLMNNNGLIAVEGPKWREQRKFA
INCMKSLGAVKVGGRRAVMESRILEGVRQTFQMIDERRQNGPFDPKPILSHTIGNIMNCI
VFGKSFSVDDQTWTWLQHMAEEGVKLVGVAGPLNFMPYLRILPQYRKLLEFIRSGQKRTH
DVYRSIACDDNRTSDNILSYYLEAISACRGQYFDEAQMLHLLADMFGAGVDSTLATFRWV
ILYLALHPEVQECVYEEVSCVIGKDKEPNMDHLSQCPFTEATIMETMRIRPVVPLGIPHG
ATKDTQLAGFRVPEGTMIIVNQWTLHHDTKYWDDPEIFDPKRFISPEGTVKRKDSLNPFQ
TGKRSCFGEELAKMVLFLFTSSIVLRYRLDVEGPATIALEGECGITLCPGPQALTFNLRP
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtctatgtcattaggagtgctgtcttgttttagtagttcggtttccttcgattatatt
atggaactattagaagaaatagggaagctgatagtgaactacgtatcatcaaacatactt
ttgtgtttgaactactttataaatggcttagagaacttcaatcttgaggacctgagcgaa
atgttgatcgcatcaattgtcctcctatgcgccaccgtgttcttctactacatgtggcgg
acccgtggcatgccaccaggcccgtggggcttgccactcgtcggttaccttccatggatc
gacaagaagaagccgtacctctcgctgatggagctgtaccaggactacggtgggatatgt
accatcaggctgggcgaagtggttgccatagtagtctcggaaccgcactacgtgaaggaa
gctctgagccaagaagtccttactgggagagcaccactctggcttactcatggcctcatg
aacaacaacggtctcatagctgtggagggaccgaaatggcgggaacagagaaaattcgca
atcaattgtatgaaaagtttaggagccgtcaaagtcggtggaaggagagcagtgatggaa
agtcgaatcttagaaggcgtcaggcagacatttcagatgatcgacgaacgccgccagaat
ggcccgttcgaccctaagcccatcctctcccacacgataggcaacattatgaactgcatc
gtcttcggaaaatcgttcagcgtggacgaccagacgtggacctggttgcagcacatggct
gaggaaggagttaaactggtcggggtcgctggtccccttaacttcatgccctatctcagg
attctgccgcagtataggaagttgttagagttcataagatccggacagaagcgaacgcac
gacgtgtacagaagtatagcatgcgatgacaacaggaccagcgataatatcctcagttat
tatctagaagcgatatctgcttgcagggggcagtacttcgacgaagcccaaatgctccac
ctcttggctgacatgtttggagccggcgtggactcgaccctggccaccttcagatgggtt
atcctctacctagccttgcatccagaagtacaggaatgtgtatatgaagaagtgtcatgc
gtgatcggtaaagacaaggaaccaaacatggatcatctgtcccaatgtcctttcacagag
gcaaccatcatggagactatgaggatcagaccggttgtcccgctaggtattcctcacgga
gctacaaaagacacgcagcttgccgggttcagggtaccagaagggacaatgatcatcgtg
aaccaatggaccttgcatcacgacacaaaatattgggacgatcctgaaatatttgatcca
aaaagatttatcagtcctgaaggtaccgtcaagaggaaggacagtttgaatcctttccaa
accggaaagaggtcctgcttcggcgaggagctggccaagatggtgctgttcctgttcact
agctcgatagtgcttaggtaccgtttagacgtggaaggccctgccacgatagctctggaa
ggagagtgcggcatcaccctatgccccgggccgcaagctctcaccttcaacctcaggcca
tga

DBGET integrated database retrieval system