KEGG   Halobacillus halophilus: HBHAL_2292
Entry
HBHAL_2292        CDS       T02031                                 
Symbol
med
Name
(GenBank) positive regulator of ComK
  KO
K05519  transcriptional activator of comK gene
Organism
hhd  Halobacillus halophilus
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hhd03000]
    HBHAL_2292 (med)
Transcription factors [BR:hhd03000]
 Prokaryotic type
  Other transcription factors
   Others
    HBHAL_2292 (med)
SSDB
Motif
Pfam: Bmp ANF_receptor
Other DBs
NCBI-ProteinID: CCG44641
UniProt: I0JKH2
LinkDB
Position
1301850..1302809
AA seq 319 aa
MKWVYTGCVLLLLLTGCNHIAGKADHAGMLVETTIDDQAWGEQGYQGLKAIEKEYGVDVS
YKEGINSYTKTVQAVEELVNQGATVILGHSHVYGNYFQQLHKQYPDIQFIYFNGAFTADN
VTSLNFSAQAMGFFGGMAAGQMTESDKVGIIAAFEWQPEVEGFYEGVNFQNPQAEVEITF
TNSWEDTDKALSQYERLEKQGADVFYPAGDVFNQAVIKQIKQDDHYAVGYVNDQSDVGGK
AVLTSTIQKVDAVYKIAMEKYLNDNLPGRPLMFDFEEGAIEMGPYSPEIPKEFQREIDRA
VKQYIETGYLPNHQNSEAR
NT seq 960 nt   +upstreamnt  +downstreamnt
gtgaagtgggtatatacaggatgtgtacttttattactgctcaccggatgtaatcatatt
gctggaaaagccgatcatgcagggatgctggtagagactaccattgatgatcaagcctgg
ggagagcaaggataccagggtttgaaagcgatagagaaagagtacggtgttgatgtttct
tataaagagggtattaatagttatacaaaaacggttcaagcggtagaagaactggtgaat
caaggggctacggtcattttgggtcatagtcatgtgtacggaaattatttccaacaattg
cataagcagtatcctgatatccagttcatttattttaatggggcctttacggcggacaat
gttaccagtctgaatttcagtgctcaggccatgggcttttttggaggcatggcagcagga
cagatgacagaaagcgataaggttggaattatcgcggcatttgaatggcagcctgaagta
gaaggattctatgaaggtgtcaattttcagaacccgcaggctgaagtcgagatcacgttt
acaaacagctgggaagatacagataaggccctcagccagtatgaacggttagagaagcag
ggggctgatgtgttttatcctgccggggatgtattcaaccaggcggtcatcaaacagata
aagcaggatgaccactatgcggtcggttacgtgaacgatcagtccgatgttggcgggaag
gctgttctcaccagtacgatacaaaaagtagatgctgtttataaaattgctatggaaaag
tacttaaacgataacctgcccggacgtccgctaatgtttgattttgaagaaggggccatt
gaaatgggaccttacagcccggagatcccgaaggagtttcaaagggaaattgaccgtgct
gtaaaacaatatatcgaaacagggtatttgcccaatcatcaaaactctgaagccagatga

DBGET integrated database retrieval system