Halorhodospira halochloris: HH1059_05070 Help Entry HH1059_05070      CDS       T06158                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism hhk  Halorhodospira halochloris Pathway hhk02024   Quorum sensing hhk03018   RNA degradation Brite KEGG Orthology (KO) [BR:hhk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HH1059_05070 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HH1059_05070 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hhk03019]     HH1059_05070 (hfq)    03036 Chromosome and associated proteins [BR:hhk03036]     HH1059_05070 (hfq) Messenger RNA biogenesis [BR:hhk03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HH1059_05070 (hfq) Chromosome and associated proteins [BR:hhk03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HH1059_05070 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Hemocyanin_N Motif Other DBs NCBI-ProteinID:  BAU57191 UniProt:  A0A120MZJ2 LinkDB All DBs Position 521875..522147 Genome browser AA seq 90 aa AA seqDB search MSKGQSLQEPFLNTLRKEKVPVSIYLVNGIKLQGQIESFDQFVVLLRNNVNQMVYKHAIS TIVPARRVRIPALGDDQPTDLEHGQEESDR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcagtcactgcaagagccgtttctaaataccctgcgcaaggagaaggtg ccggtatctatatatttggttaatgggataaagcttcagggccagatcgaatccttcgat caatttgtggttttattgcgcaataatgtaaatcagatggtctataaacatgcaatctca actatagtcccggcgcggcgggtgcggatacctgcgcttggggacgatcagcctaccgac cttgaacacggtcaggaggagagcgatcgctga

DBGET integrated database retrieval system