KEGG   Helicobacter pylori Shi112: HPSH112_04130
Entry
HPSH112_04130     CDS       T02037                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hhp  Helicobacter pylori Shi112
Pathway
hhp00540  Lipopolysaccharide biosynthesis
hhp01100  Metabolic pathways
Module
hhp_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hhp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSH112_04130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hhp01005]
    HPSH112_04130
Lipopolysaccharide biosynthesis proteins [BR:hhp01005]
 Lipid A
  HPSH112_04130
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFI01027
LinkDB
Position
835299..836417
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKHQTPPYAFLHNQTLSTKSPPYFTQFTIPKPDGA
LSVHASALISLPNDNLLSAYFSGTKEGARDVTISANLFDSKINRWSEAFIILTKEELSYY
SHEYIKKLGNPLLFLHGDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVQKLSLSPF
LNLSHLIRNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcaccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccaaaagccccccctatttcacacaattcactatccctaaaccagatggtgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgacaatcagcgcgaatctttttgacagc
aagatcaatcgctggagtgaagccttcatcattttaaccaaagaagagctttcttattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatggcgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcactttaagtttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaggaataagcctttaaacaccactgatggcgggtttatg
ctaccgctttaccacgaattagccacccaataccccttgttgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagactgcgctgtcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaacttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatcactgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatatcaagcacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system