KEGG   Helicobacter pylori Shi169: HPSH169_02985
Entry
HPSH169_02985     CDS       T02038                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hhq  Helicobacter pylori Shi169
Pathway
hhq00540  Lipopolysaccharide biosynthesis
hhq01100  Metabolic pathways
Module
hhq_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hhq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSH169_02985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hhq01005]
    HPSH169_02985
Lipopolysaccharide biosynthesis proteins [BR:hhq01005]
 Lipid A
  HPSH169_02985
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFH99295
UniProt: A0A0E0WD75
LinkDB
Position
complement(600089..601207)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFMHNQTLSTKNPPYFTQLTIPKPDGA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQFESTLEPIHFKFVQKLSLSPF
LNLSHLIKNKPLSTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMTYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttatgcacaatcaaacc
ctttcaaccaaaaacccaccctatttcacacagctcactatccctaaaccagatggtgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagtgaagccttcatcattttaaccaaagaagagctttctcattat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaattt
gaaagcactttagagccgattcattttaagtttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaagcaccactgatggagggtttatg
ctaccactctatcacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagcttcagccaagccta
accccctttaaagactgtgctgtcatggcgtttagaaaccattctttaaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatcactgcgccgtaaagaactcttactttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatgacctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system