Hyaena hyaena (striped hyena): 120238026 Help Entry 120238026         CDS       T07257                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04060   Cytokine-cytokine receptor interaction hhv04061   Viral protein interaction with cytokine and cytokine receptor hhv04151   PI3K-Akt signaling pathway hhv04625   C-type lectin receptor signaling pathway hhv04630   JAK-STAT signaling pathway hhv04658   Th1 and Th2 cell differentiation hhv04659   Th17 cell differentiation hhv04660   T cell receptor signaling pathway hhv04672   Intestinal immune network for IgA production hhv04940   Type I diabetes mellitus hhv05135   Yersinia infection hhv05142   Chagas disease hhv05162   Measles hhv05166   Human T-cell leukemia virus 1 infection hhv05171   Coronavirus disease - COVID-19 hhv05200   Pathways in cancer hhv05320   Autoimmune thyroid disease hhv05321   Inflammatory bowel disease hhv05330   Allograft rejection hhv05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120238026 (IL2)    04151 PI3K-Akt signaling pathway     120238026 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120238026 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     120238026 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120238026 (IL2)    04660 T cell receptor signaling pathway     120238026 (IL2)    04658 Th1 and Th2 cell differentiation     120238026 (IL2)    04659 Th17 cell differentiation     120238026 (IL2)    04672 Intestinal immune network for IgA production     120238026 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120238026 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120238026 (IL2)    05171 Coronavirus disease - COVID-19     120238026 (IL2)    05162 Measles     120238026 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     120238026 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     120238026 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     120238026 (IL2)    05321 Inflammatory bowel disease     120238026 (IL2)    05330 Allograft rejection     120238026 (IL2)    05332 Graft-versus-host disease     120238026 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     120238026 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120238026 (IL2)    00536 Glycosaminoglycan binding proteins [BR:hhv00536]     120238026 (IL2) Cytokines and neuropeptides [BR:hhv04052]  Cytokines   Interleukins    120238026 (IL2) Glycosaminoglycan binding proteins [BR:hhv00536]  Heparan sulfate / Heparin   Cytokines    120238026 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  120238026 NCBI-ProteinID:  XP_039097533 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MYKIQLLSCIALTLVLVANSAPASSSTKETQQQLEQLLLDLRLLLNGVNNHENPKLSRML TFKFYMPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLRHIKELMSNINVTVLKLKGS ETRFTCEYDDETANIVEFLNKWITFCQSIFSTLS NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaattcaactcctgtcttgcatcgcactgactcttgtactcgttgcaaacagt gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat ttacggttgcttttgaatggagttaataatcatgagaaccccaaactctccaggatgctc acatttaaattttacatgcccaagaaggccacagaattgacacaccttcagtgtctagta gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg agacacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct gaaacaagattcacatgtgaatatgatgatgagaccgcaaacattgtagaatttctgaat aaatggattaccttttgtcaaagcatcttctcaacattgagttga

DBGET integrated database retrieval system