KEGG   Hyaena hyaena (striped hyena): 120242254
Entry
120242254         CDS       T07257                                 
Name
(RefSeq) integrin alpha-X-like
  KO
K06462  integrin alpha X
Organism
hhv  Hyaena hyaena (striped hyena)
Pathway
hhv04610  Complement and coagulation cascades
hhv04810  Regulation of actin cytoskeleton
hhv05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hhv00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    120242254
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    120242254
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    120242254
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hhv04515]
    120242254
   04090 CD molecules [BR:hhv04090]
    120242254
Cell adhesion molecules [BR:hhv04515]
 Integrins
  Integrin alpha subunits
   120242254
CD molecules [BR:hhv04090]
 Proteins
  120242254
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 FG-GAP_2 VWA_CoxE DUF333 STATa_Ig
Other DBs
NCBI-GeneID: 120242254
NCBI-ProteinID: XP_039103816
LinkDB
Position
Unknown
AA seq 1064 aa
MSYLPVMTRIRTSLLLLMGLASSLCFNLDTEQPTTFLMESAGFGYSVVQYANSWVMVGAP
QESKAANQTGGLYQCQYSTGKCEPVHLKIPPEAVNMSLGLSLAASTNPSQLLACGPTVHH
ICKENVYLTGFCFLLASPSGQVQRHPAALQECPRQEQDIVLLIDGSGSISSRDFSKMLNF
VKAVMSQFQRPSTQFSLMQFSRDVRVHFTFKDFIHSSNPLGLVDSVVQLNGLTYTATAIQ
MVTNQLLSASNGARKDASKILIVITDGRKEGDPLGYEDVIPRAEDAGIIRYAVGVGLAFQ
QPYSWKELNAIASKPSHEHIFTVENFDALRDIQNKLKEKIFAIEGTQTISSSSFELEMSQ
EGFSAVFSPDGPVLGAVGSFTWSGGAFLYPQNMRPTFINMSQENVDMRDSYLGYSTELAF
WKGVKSLILGAPRHQHTGKVVIFTWTSEQWRPNAEVAGTQIGSYFGASLCAVDVNRDGSS
DLVLIGAPNYYKPTQGGQVSMCHLPQGKAKWQCEAVLCGEQGHPWGRFGAALTVLGDVNG
DKLTDVAIGAPGEQENRGAVYIFHGTSELGISVSHSQRISASQLSPSLQYLGQSLSGGQD
LTQDGLVDLAVGAQEHVLLLRTRPVLRVWVSLQFTATEIARSAFECQEETASAKALGGAN
VCLHVYESPKNRLGDLQSTVTFDLTLDPGRQNPRAIFEETKARNLTHVRVLGLRQYCETV
RLLLLACVEDVVTPITLRLNFSLVGKPIPSFGNLQPILAVDAQRYFTASLPFEKNCGTDH
VCQDDLGISFDFSGLKTLVVGSTLELNMKVTVWNDGEDSYGTSVTFFYPPGLSYRRVARS
QNQLQAQSPRLTCEGIPAQGQSTQSTRCSINHLIFREGAKMTFTVTFDVSPKAVLGDRLL
LKANVSSENNTPRTNKTTFQMELMVKYAIYTVISSHEQSTKYLNFSASDLEESNQVQHRY
QVNNLGQRDLPVNITFSVPVELNGVSMWTALEVSHPQNPFIQCSSEKMVPTDSDFLTHIQ
KNPVLNCSIADCQRFRCDLPSFEIQEELDFILKGNLSFGWISQT
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgtcttaccttccagtcatgaccaggatcaggacatccctcctcctgttgatgggcttg
gcttcttctctctgtttcaacttggacacagagcagccaacaaccttccttatggagagt
gctgggtttggatacagtgtggtccagtatgccaactcctgggtaatggttggagccccc
caggaatcaaaggctgccaaccagacaggtggcctctaccagtgtcaatacagcacgggc
aagtgtgagcccgtccacctgaagattcccccagaagctgtgaacatgtccctcggcctg
tccctggcagcctccaccaacccttctcagctgctggcctgcggccccacagtgcaccat
atatgcaaggagaacgtgtacttgaccgggttctgtttcctgctggcttccccttctggg
caggtccagaggcacccggctgccctgcaggagtgtccaaggcaggagcaggatattgtg
ttgctgattgatggctcaggcagcatctcctccagagattttagcaagatgttgaatttt
gtgaaggctgtgatgagccagttccagagacctagcacccagttctccctgatgcagttc
tcccgcgatgttcgggtgcacttcactttcaaagacttcatacacagctcaaacccacta
ggcctggtggattctgtagtccagctgaacgggctcacttacacagctacagccatccaa
atggtcacaaaccaactgctcagtgcctcaaatggggcccgaaaagatgcctccaagatc
cttattgtcatcactgatggtcggaaagaaggcgaccccttgggttatgaggatgtcatc
cctagagctgaagatgcaggcatcatccgctatgcagttggggtgggattggcttttcaa
cagccatattcctggaaagaattaaatgccattgcatcgaagccctcccatgagcacatt
tttacagtggagaattttgatgctttgagagacattcaaaacaaactgaaagagaagatc
tttgccattgagggtacacagaccataagcagtagttcctttgaattggagatgtcccag
gagggcttcagcgctgtgttctcacctgatggcccagttctgggggctgtggggagcttc
acctggtctggaggagccttcctgtacccccaaaatatgagacccactttcatcaacatg
tctcaagagaatgtggatatgagggactcctacctgggttactccaccgagctggccttt
tggaagggggtgaagagcctgatcctgggggccccccgccatcagcatactgggaaggtt
gtcatcttcacctggacatctgagcaatggagaccaaatgctgaagtcgcagggacccag
atcggctcctactttggggcctccctctgcgctgtggatgtgaacagagatggcagctct
gacctcgtcctcattggggctcccaattactacaagccaacccagggggggcaggtgtcc
atgtgccacttgccccaggggaaggctaagtggcagtgtgaggccgttctctgtggggag
cagggccacccctggggccgctttggggcagccctgacagtgctgggggatgtgaatggg
gacaagctgacagacgtggccatcggggccccaggagagcaagagaaccggggtgctgtc
tacatatttcatggaacctcagaactgggcatcagcgtctcccacagccagcggatctca
gcctcccagctctctcccagcctccagtatttggggcagtcactgagtgggggtcaggac
cttacccaggatggactggtggacctggctgtgggagcccaagaacatgtgctattgcta
aggaccagacctgtgctcagggtgtgggtgagtctccaattcacagctacagagattgcc
aggtctgcgtttgagtgtcaggaggagacagcttctgccaaggcactgggtggtgccaat
gtctgccttcatgtttatgaaagtcccaagaatcggctgggtgacctccaaagcactgtg
acctttgacctgaccctcgaccccggccgccagaatccccgtgccatctttgaagagaca
aaagcccggaatctgactcatgtccgagtccttgggctgaggcagtactgtgagaccgtg
aggttgctcctcctggcttgtgtggaggacgtggtgacccccatcaccttgcgtctcaac
ttctccctggtgggcaaacctatcccttcctttggaaacctccagcctatattggctgtg
gatgctcagcgatacttcacggcctctcttccctttgagaagaattgtggaactgaccac
gtctgccaggatgaccttggcatctcctttgacttctcaggcttgaagactctggtggtg
gggagtaccctggaactgaatatgaaagtgacagtgtggaatgatggtgaagactcctat
ggaacttcagtgaccttcttctacccgccagggctgtcttatcgtcgtgtggcaaggagc
cagaaccagctgcaagcacaatccccacgcctgacctgtgaaggcatcccagcccagggc
cagagtactcagagcacccgttgcagcatcaaccacctcatcttccgtgagggtgctaag
atgaccttcacagtcacctttgatgtctcccctaaggctgtactgggtgatcggttgctt
ctgaaagctaatgtgagcagtgaaaataatactcccaggaccaacaagaccacctttcag
atggagctcatggtgaagtacgctatctacactgtgatcagcagccatgaacagtccacc
aagtacctcaacttctcagcctcagacttggaggaaagtaaccaggttcagcatagatac
caggtgaacaatctgggacagagggacctgcctgtcaacatcaccttctctgtgcctgtg
gagctgaatggggtgtctatgtggacagcgttagaggtttcccacccccagaatcccttc
attcagtgttcttcagagaaaatggtgccaacagattctgacttcctgacccacattcag
aagaatcctgtgctgaactgctccattgctgactgccagaggttccgctgtgacctgccc
tcctttgaaatccaggaggaacttgacttcatcctgaagggcaacctcagctttggctgg
atcagccagacatag

DBGET integrated database retrieval system