Hylobates moloch (silvery gibbon): 116474527 Help Entry 116474527         CDS       T08803                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh04060   Cytokine-cytokine receptor interaction hmh04061   Viral protein interaction with cytokine and cytokine receptor hmh04062   Chemokine signaling pathway hmh04620   Toll-like receptor signaling pathway hmh04621   NOD-like receptor signaling pathway hmh04623   Cytosolic DNA-sensing pathway hmh04668   TNF signaling pathway hmh05020   Prion disease hmh05142   Chagas disease hmh05163   Human cytomegalovirus infection hmh05164   Influenza A hmh05168   Herpes simplex virus 1 infection hmh05323   Rheumatoid arthritis hmh05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hmh00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     116474527 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116474527 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     116474527 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116474527 (CCL5)    04621 NOD-like receptor signaling pathway     116474527 (CCL5)    04623 Cytosolic DNA-sensing pathway     116474527 (CCL5)    04062 Chemokine signaling pathway     116474527 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     116474527 (CCL5)    05168 Herpes simplex virus 1 infection     116474527 (CCL5)    05163 Human cytomegalovirus infection     116474527 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     116474527 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     116474527 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     116474527 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     116474527 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hmh04052]     116474527 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:hmh00536]     116474527 (CCL5) Cytokines and neuropeptides [BR:hmh04052]  Cytokines   Chemokines    116474527 (CCL5) Glycosaminoglycan binding proteins [BR:hmh00536]  Heparan sulfate / Heparin   Chemokines    116474527 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 MF_alpha_N Motif Other DBs NCBI-GeneID:  116474527 NCBI-ProteinID:  XP_032018931 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSAAALTVILIATALCAPASASPYASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP AVVFVTRKNRQVCANPEKKWVREYINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcggcggccctcactgtcatcctcattgctaccgccctctgcgctcct gcatctgcctccccatatgcctcggacaccacaccctgctgctttgcctatattgcccgc ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg gttcgggagtacattaactctttggagatgagctag

DBGET integrated database retrieval system