Hylobates moloch (silvery gibbon): 116812143 Help Entry 116812143         CDS       T08803                                  Name (RefSeq) histone H2A-Bbd type 2/3   KO K11251   histone H2A Organism hmh  Hylobates moloch (silvery gibbon) Pathway hmh03082   ATP-dependent chromatin remodeling hmh04217   Necroptosis hmh04613   Neutrophil extracellular trap formation hmh05034   Alcoholism hmh05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hmh00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     116812143  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     116812143  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     116812143  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     116812143   09165 Substance dependence    05034 Alcoholism     116812143  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hmh03036]     116812143   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hmh04147]     116812143 Chromosome and associated proteins [BR:hmh03036]  Eukaryotic type   Nucleosome assembly factors    Histones     116812143 Exosome [BR:hmh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116812143 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  116812143 NCBI-ProteinID:  XP_032613726 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MPRRRSHRGSSGAGGRGRTCSRTVRAELSFSVSQVERGLREGHYAQRLSRTAPVYLAAVI EYLTAKVLELAGNEAQNNGERNITPLLLDMVVHNNRLLSTLFDTTTISQVAPGGD NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgccgaggaggaggagccaccgagggtcctccggtgctggcggccgggggcggacctgc tctcgcaccgtccgagcggagctttcgttttcggtgagccaggtggagcgcggtctacgg gagggccactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt gagtacctgacggccaaggtcctggagctggcgggcaacgaggcccagaacaacggagag aggaacatcactcccctgctgctggacatggtggttcacaacaacaggctgctgagcacc cttttcgacacaaccaccatctctcaagtggcccccggcggggactag

DBGET integrated database retrieval system