KEGG   Halobacillus mangrovi: HM131_14780
Entry
HM131_14780       CDS       T04799                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
hmn  Halobacillus mangrovi
Brite
KEGG Orthology (KO) [BR:hmn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hmn03000]
    HM131_14780
Transcription factors [BR:hmn03000]
 Prokaryotic type
  Other transcription factors
   Others
    HM131_14780
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: ARI79225
UniProt: A0A1W6A0R1
LinkDB
Position
complement(2976258..2977115)
AA seq 285 aa
MLVETTIHDQAWGQQGYKGLQSIQDEYGVDIYFKEGIKSYSQTIQAVDHLVNKGVNIIFG
HSNIYGKHFQQLHKQYPDVQFIYFNGQFTAENVTSLNFSANAMGFFAGMVAGKMTEADLI
GIIASFEWQPEVEGFYEGVMYQNPEADVHIAYTNSWENTDKARMLYEQMEEEGADVFYPA
GDIFNVPVINEVQKDGHYAIGYVSDQSSVAENTVLTSTVQKVDVVYNLAMDRYVEGELPG
KPLTFDFQDGAIKLGEYSPEIPESFQKQMDDLIEQYMKTGKLPNE
NT seq 858 nt   +upstreamnt  +downstreamnt
atgcttgtcgaaacgaccattcacgatcaagcctggggccagcagggatataaaggctta
caatccattcaggacgagtatggagtggatatttactttaaagaaggaattaaaagttat
tcccaaactattcaagctgtcgatcatttagtcaataaaggcgtcaatattatattcggt
cacagcaacatttatgggaaacattttcaacaacttcataaacaatatccagatgttcag
ttcatttattttaatggtcagtttactgcagaaaatgtgacgagtttgaatttcagtgcc
aatgcgatgggattcttcgcaggtatggttgcagggaaaatgacagaagcagatctgatc
ggtatcattgcttcttttgaatggcagccagaagtagaaggtttttatgagggtgtcatg
tatcaaaatcctgaagcagatgtccatatcgcttataccaacagctgggaaaacacggat
aaagcacggatgctgtatgaacagatggaagaagaaggggctgatgtcttttatcctgca
ggagacatttttaatgttcctgtgatcaatgaagttcaaaaggatggacattatgcaatc
gggtatgtatctgatcaatcctctgtggcagaaaatacggtgttgacgagcactgtccaa
aaggttgatgtggtttacaatctggccatggatcgatatgtagaaggagaacttcctggt
aagccgctaacgtttgactttcaggacggggccattaaactgggagaatacagccccgaa
atccctgaatctttccaaaagcagatggatgatttgatcgaacagtatatgaaaactgga
aagcttcccaacgaatag

DBGET integrated database retrieval system