KEGG   Haliangium ochraceum: Hoch_3571
Entry
Hoch_3571         CDS       T01103                                 

Name
(GenBank) Glutaryl-7-aminocephalosporanic-acid acylase
  KO
K07116  acyl-homoserine-lactone acylase [EC:3.5.1.97]
Organism
hoh  Haliangium ochraceum
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hoch_3571
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.97  acyl-homoserine-lactone acylase
     Hoch_3571
SSDB
Motif
Pfam: Penicil_amidase
Other DBs
NCBI-ProteinID: ACY16073
UniProt: D0LX31
LinkDB
Position
4919340..4921478
AA seq 712 aa
MKRVLFGLLVVCGAALAAAGVWLAVRPPAVPPELAERGAAYDVEILRDTWGVPHIFGKRD
TDVAYGLAYAHAEDDFATIQGTLLAARGELARVHGEHAAPNDYMVHLLRIRDVVAAGYPE
LDAATRALCDAYADGINHYAALHPEQAVRDFYPVRGDDVVAGFVHKVPLFYKLDRVLGEL
FSDEGPEKSGGEHTRRDAAEEPAPMGSNAFAVAPSRSADGSTRLVVDPHQPWTGPVAWYE
AHVRSEEGWDAVGALFPGAPVLLVGHNRDLGWSHTVNEPDLIDVFELVMDPEDDKRYRFG
DEWRTLEQRVAPIEVSLWGPLSWTFEREVLWSEHGPVVQRPHGTYAIRLASYGEVGAIEQ
WYGMNKATTLESWKQAMRALAVPMFNTIYADREGNILYVYNARLPLRAEGYEWAGLLPGE
RAEVVWDEFLPFDRLPMVENPAAGFVQNCNSTPFETTSGADNPARDAYPASFGIELFQTN
RAMRARALLEQDQDITADELLAIKFDTRYASDSRLAGFIAQIAAAPAPSEPALAEAVTML
GAWDLDASGDSEAAALAILAFAKPMRQHRDTIPTEELMASLAEAVEVLETHHGSIHVPLA
ELQRLRRGEVEVGLDGGPDTLRAIHADLEDGHLIGHAGDSHVMLVEWDAEGRVRSRSLQP
YGNAKRDPQSPHYADQAALFAAHALKPVWYEEADIRRNLERAYVPGEEERAE
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgaagcgtgtccttttcgggttgctggtcgtctgcggggcggcgctcgcggccgccggg
gtctggctcgccgttcgtccgccagcggttccgccggagttagctgagcgtggcgcagct
tacgatgttgagatcctgcgtgacacctggggcgtgccccatattttcggcaagcgcgac
accgacgtcgcctacggtctggcctatgcccacgccgaggacgacttcgccaccatccag
ggtacgctgctcgccgcccgcggggagctggcccgggtccacggcgagcatgctgcgccc
aacgactacatggtccatctcctgcgtatacgcgacgtggtcgccgccggttaccccgag
ctcgacgccgccacccgcgcgctgtgcgacgcgtacgccgacggcatcaaccactacgcc
gcgctgcaccccgagcaggcggtgcgcgacttctacccggtgcgcggcgacgacgtggtc
gccggcttcgtgcacaaggtcccgctgttctacaagctcgaccgcgtgctgggcgagctg
ttctcggacgaaggaccggaaaagagcggcggcgagcacacccggcgggacgcggccgag
gagcccgcgcccatgggctcgaacgccttcgccgtggcgccgagccgcagcgccgacggc
agcacccggctggtcgtcgatccccaccagccgtggaccggcccggtggcctggtacgag
gcccacgtccgcagcgaagagggctgggacgcggtcggcgcgctgtttcccggcgccccc
gtgctcctggtcggccacaaccgcgacctcggctggtcgcacaccgtcaacgagcccgac
ctcatcgacgtcttcgagctggtgatggatcccgaggacgacaagcgctaccgcttcggc
gacgagtggcgcacgctcgagcagcgcgtggccccgatcgaggtgtcgctgtgggggccg
cttagctggaccttcgagcgcgaggtgttgtggtccgagcacggccccgtggtccagcgc
ccgcacggcacctacgccatccgcctggccagctacggcgaggtcggcgccatcgagcag
tggtacggcatgaacaaggcgaccacgctcgagagctggaagcaggccatgcgcgcgctg
gcggtgccgatgttcaacaccatctacgccgaccgcgagggcaacatcctctatgtatac
aacgcccgcctgccgctgcgcgcggagggctacgagtgggccgggttgctgcccggcgag
cgcgccgaggtggtgtgggacgagtttttgcccttcgaccgcctgcccatggtcgagaat
ccggccgcgggcttcgtgcagaactgcaacagcacgcccttcgagaccaccagcggcgcc
gacaacccggcccgcgacgcctatcccgcgtcctttggcatcgagctgttccagaccaac
cgggccatgcgcgcgcgcgcgctgctcgagcaggaccaggacatcaccgccgacgagctt
ctggccatcaagttcgacacccgctacgccagcgactcgcgcctggccggcttcatcgcc
cagatcgcggccgcgccggcgcccagcgagcccgcgctggccgaggccgtgaccatgctc
ggcgcctgggatctcgacgccagcggcgacagcgaggccgccgcgctggccatcctggcc
tttgccaagcccatgcgccagcaccgcgacaccatccccaccgaggagctgatggcgtcc
ctggccgaggccgtcgaggtgctcgagacccatcacggcagcatccacgtgccgctggcc
gagctgcagcggctgcgccgcggcgaggtcgaggtcgggctcgacggcggccccgacacg
ctgcgcgcgatccacgccgacctcgaagacgggcatctcatcggccacgccggcgactcg
cacgtgatgctggtcgagtgggacgccgagggccgggtgcgctcgcgcagcctgcagccc
tacggcaacgccaagcgcgacccgcagtcgccgcactacgccgatcaggcggccctgttc
gcggcccacgcgctcaagccggtgtggtacgaggaggccgacatccggcgcaacctcgag
cgcgcctacgtacccggcgaagaagagcgggccgagtaa

DBGET integrated database retrieval system