Vreelandella olivaria: HORIV_25450 Help Entry HORIV_25450       CDS       T06227                                  Name (GenBank) hypothetical protein   KO K03666   host factor-I protein Organism hol  Vreelandella olivaria Pathway hol02024   Quorum sensing hol03018   RNA degradation Brite KEGG Orthology (KO) [BR:hol00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HORIV_25450  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HORIV_25450  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hol03019]     HORIV_25450    03036 Chromosome and associated proteins [BR:hol03036]     HORIV_25450 Messenger RNA biogenesis [BR:hol03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HORIV_25450 Chromosome and associated proteins [BR:hol03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HORIV_25450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Motif Other DBs NCBI-ProteinID:  BBI50124 UniProt:  A0ABM7GHM0 LinkDB All DBs Position 1779533..1779706 Genome browser AA seq 57 aa AA seqDB search MVNGIKLQGQIESFDQFVILLRNTVSQMVYKHAISTVVPSRNVRLPAQDPAEQDAEI NT seq 174 nt NT seq  +upstreamnt  +downstreamnt ttggtcaacggcattaagctgcagggccagatcgaatcgtttgaccagtttgttatcctg ctgcgcaataccgtcagtcagatggtttacaaacacgctatttctacggttgttccgtct cgtaacgtacgcttgcctgcgcaagacccggcagagcaggatgcggagatttaa

DBGET integrated database retrieval system