Haemophilus parahaemolyticus: E5Q53_07065 Help Entry E5Q53_07065       CDS       T06595                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism hpaa  Haemophilus parahaemolyticus Pathway hpaa02024   Quorum sensing hpaa03018   RNA degradation Brite KEGG Orthology (KO) [BR:hpaa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     E5Q53_07065 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     E5Q53_07065 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hpaa03019]     E5Q53_07065 (hfq)    03036 Chromosome and associated proteins [BR:hpaa03036]     E5Q53_07065 (hfq) Messenger RNA biogenesis [BR:hpaa03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      E5Q53_07065 (hfq) Chromosome and associated proteins [BR:hpaa03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     E5Q53_07065 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QEN11204 UniProt:  A0AAE6MPC9 LinkDB All DBs Position complement(1466702..1466986) Genome browser AA seq 94 aa AA seqDB search MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARAISHGNNHNSHAPVHVTQTVEIVENVTE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggtcaatcattacaagacccttacttaaatgcactacgtcgtgaacgtatt ccagtttcaatttatttagttaatggaatcaaactacaaggacagatcgaatcattcgac caattcgttattttattgaaaaacacggtaagccaaatggtttacaaacacgcgatttca actgtggtgcctgctcgagcaatttctcacggcaataaccacaattcacatgccccagtg cacgtgacacaaaccgttgaaattgttgaaaacgtaacggaataa

DBGET integrated database retrieval system