KEGG   Helicobacter pylori 51: KHP_0738
Entry
KHP_0738          CDS       T02082                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpd  Helicobacter pylori 51
Pathway
hpd00540  Lipopolysaccharide biosynthesis
hpd01100  Metabolic pathways
Module
hpd_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    KHP_0738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpd01005]
    KHP_0738
Lipopolysaccharide biosynthesis proteins [BR:hpd01005]
 Lipid A
  KHP_0738
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ACX97943
UniProt: D0ISQ0
LinkDB
Position
793355..794473
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFLHNQTLSTKNPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFVILTKEELSFY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFVQKLSLSPF
LNLSHLMRNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
SSDLSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccaaaaaccccccctatttcactcagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcgttattttaaccaaagaagagctttctttttat
tcgcatgagtatatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccaattcgttttaaatttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttaatgaggaataagcctttaaacaccactgatggcgggtttatg
ctaccgctttatcacgaattagccacccaataccccttgttgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagactgcgccatcatggcgtttagaaaccattctttaaaagatagtctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgctgacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
tctagcgatttatctttgcgccgtaaagaactcctgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcgaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatatcaaacatatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system