KEGG   Helicobacter pylori F30: HPF30_0747
Entry
HPF30_0747        CDS       T01895                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpf  Helicobacter pylori F30
Pathway
hpf00540  Lipopolysaccharide biosynthesis
hpf01100  Metabolic pathways
Module
hpf_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPF30_0747
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpf01005]
    HPF30_0747
Lipopolysaccharide biosynthesis proteins [BR:hpf01005]
 Lipid A
  HPF30_0747
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: BAJ56844
UniProt: E6NJ91
LinkDB
Position
803496..804614
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFAHNQTLSTESPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFILLTKEELSYY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESTLEPIRFKFVQKLSLSPF
LNLSHLIRNKPLSTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNNQLQPSL
TPFKDCAVMAFRNHSLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSGLSLRRKELLLSKLENSNSFKTLKILDKADEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttgcacacaatcaaacc
ctttcaaccgagagccccccctatttcactcagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcattcttttaaccaaagaagagctttcttattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgttgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcactttagagccgattcgttttaaatttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaggaataagcctttaagcaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagaacttttaaggcctaatgccctaaacaaccagctccagccaagccta
accccctttaaagactgcgcagtcatggcgtttagaaaccattctttaaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcggtttatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcggatgaagtgagctacccaagctatagc
cttaaccctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system