KEGG   Helicobacter pylori G27: HPG27_539
Entry
HPG27_539         CDS       T00777                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpg  Helicobacter pylori G27
Pathway
hpg00540  Lipopolysaccharide biosynthesis
hpg01100  Metabolic pathways
Module
hpg_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPG27_539
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpg01005]
    HPG27_539
Lipopolysaccharide biosynthesis proteins [BR:hpg01005]
 Lipid A
  HPG27_539
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ACI27300
UniProt: B5Z6V1
LinkDB
Position
complement(578951..580027)
AA seq 358 aa
MGLFIVSFLIIMKRQTPPYAFTHNQTLVTQNPPYFTQLTIPKPNDALSVHASSLISLPND
NLLSAYFSGTKEGARDVKISANLFNNKTNRWSEAFTILTKEDLSHHSHEYIKKLGNPLLF
LHDDKILLFVVGVSMGGWATSKVYQFESALEPIRFKFARKLSLSPFLNLSHLIKNKPLST
TDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNTLNHQLQPSLTPFKDCAVMAFRNH
SFKDSLMLETCKTPTIWQKPMLTNLKNLNDALNLINLNKELFLIHNPSDLSLRRKELLLS
KLENPNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHIRFNMAYLKSLLK
NT seq 1077 nt   +upstreamnt  +downstreamnt
gtggggctttttatcgtttcatttttaattataatgaagcgccaaacccccccctatgct
ttcacgcacaatcaaacccttgttactcaaaaccccccctatttcacgcaactcactatc
cctaaaccaaatgacgctttaagcgtgcatgcgagctctttaatcagcttgcctaatgat
aacctcttgagcgcttattttagcggcactaaagaaggggcaagggatgtgaaaatcagc
gcgaatctttttaataacaagactaatcgctggagcgaagccttcactattttaaccaaa
gaagatctttctcatcattcgcatgaatacatcaaaaaactgggtaatcctttgcttttt
ttgcatgacgataagattttgttgtttgtcgtaggggtgagcatgggcgggtgggccact
tctaaagtctatcaatttgaaagcgctttagagccgattcgttttaagtttgcgcgaaaa
ctctctttaagcccttttttaaacttaagccatttgataaaaaataagcctttaagcacc
actgatggcgggtttatgctaccgctctatcacgaattagccacccaataccccctattg
ttgaaatttgaccaacaaaataacccaagagagcttttaaggcctaataccttaaaccac
cagctccaaccaagcctaaccccctttaaagactgcgctgtcatggcgtttagaaaccat
tcttttaaagatagcctcatgctagaaacctgtaaaacccctactatttggcaaaaaccc
atgcttacgaatttgaaaaacttgaatgacgctttgaacttgatcaacttaaacaaagaa
ttgtttttgatccacaaccctagcgatttatctttgcgtcgtaaagaactcttgctttct
aaattagaaaacccaaactcttttaaaaccttaaaaattttagataaagccaatgaagtg
agttacccaagctatagtcttaattctcattttatagatattgtctatacctacaaccgc
tctcatatcaaacacatccgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system