KEGG   Helicobacter pylori Lithuania75: HPLT_02885
Entry
HPLT_02885        CDS       T01896                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hph  Helicobacter pylori Lithuania75
Pathway
hph00540  Lipopolysaccharide biosynthesis
hph01100  Metabolic pathways
Module
hph_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hph00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPLT_02885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hph01005]
    HPLT_02885
Lipopolysaccharide biosynthesis proteins [BR:hph01005]
 Lipid A
  HPLT_02885
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ADU83003
UniProt: E8QP71
LinkDB
Position
complement(569275..570207)
AA seq 310 aa
MHASALISLPNDNLLSAYFSGTKEGAKDVKISANLFDSKTNRWSEAFILLTKEELSHHSH
EYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPFLN
LSHLIKNKPLSTTDGGFVLPLYHELATQYTLLLKFDKNNNPRELLRPNALNHQLQPSLTP
LKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHNPS
DLSLRRKELLLSKLENSNSFKTLKILDKADEVSYPSYSLNPHFIDIVYTYNRSHIKHIRF
NMAYLKSLLK
NT seq 933 nt   +upstreamnt  +downstreamnt
gtgcatgcgagcgctttaatcagcttgcctaacgataacctcttgagcgcttattttagc
ggcactaaagaaggggcaaaggatgtgaaaatcagcgcgaatctttttgacagcaaaact
aatcgctggagcgaagccttcattcttttaaccaaagaagagctttctcatcattcgcat
gaatatatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaattttgttg
tttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaacttgaaagc
gctttagagccgattcgttttaagtttgcgcgaaaactctctttaagcccttttttaaac
ttaagccatttgataaaaaataaacccttaagcaccactgatggcggttttgtgctaccg
ctctatcacgaattagccacccaatacacattattgttgaaatttgacaaaaacaataac
ccaagagagcttctaaggcctaatgccctaaaccaccagctccagccaagcctaaccccc
cttaaagattgcgctatcatggcgtttagaaaccattcttttaaagatagcctcatgcta
gaaacctgtaaaacccctaccgcttggcaaaaacccatgcttacgaatttgaaaaacttg
aatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaaccctagc
gatttatcactgcgccgtaaagaactcttgctttctaaattagaaaactcaaactctttt
aaaaccttaaagattttagataaagcggatgaagtgagttacccaagctatagtcttaat
cctcattttatagatattgtctatacctataaccgctctcatatcaaacacatccgtttt
aatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system