KEGG   Helicobacter pylori B8: HPB8_776
Entry
HPB8_776          CDS       T01262                                 
Name
(GenBank) conserved hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpl  Helicobacter pylori B8
Pathway
hpl00540  Lipopolysaccharide biosynthesis
hpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPB8_776
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpl01005]
    HPB8_776
Lipopolysaccharide biosynthesis proteins [BR:hpl01005]
 Lipid A
  HPB8_776
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: CBI66333
UniProt: D7FDR2
LinkDB
Position
complement(747510..748523)
AA seq 337 aa
MHNQTLSTESPPYFTQLTIPKPDDALSVHASALINLPNDNLLSAYFSGTKEGARDVKISA
NLFNNKTNRWSEAFILLTKEELSKNAHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATS
KIYQFESALEPIRFKFARKLSLSPFLNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLL
KFDQQNNPRELLRPNALNHQLQPSLTPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPM
LTNLKNLNDALNLINLNKELYLIHNPSDLSLRRKELLLSKLENSNSFKTLKILDKADEVS
YPSYSLNPHFIDIVYTYNRSHIKHIRFNMAYLKSLLK
NT seq 1014 nt   +upstreamnt  +downstreamnt
gtgcacaatcaaaccctttcaactgaaagccccccctatttcacacaactcaccatccct
aaaccagatgacgctttaagcgtgcatgcgagcgctttaatcaatttgcctaacgataac
ctcttgagcgcttattttagcggcactaaagaaggggcaagagatgtgaaaatcagcgcg
aatctttttaataacaaaactaatcgctggagcgaagccttcattcttttaaccaaagaa
gagctttccaaaaacgcgcatgaatacatcaaaaaactgggtaaccccttgctttttttg
catgacgataaaatcttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttct
aaaatctatcaatttgaaagcgctttagagccgattcgttttaagtttgcgcgaaaactc
tctttaagcccttttttaaacttaagccatttgataaaaaataagcctttaaacaccact
gatggcgggtttatgctaccactctatcacgaattagccacccaataccccttgttgttg
aaatttgaccaacaaaataacccaagagagcttttaaggcctaatgccctaaaccaccag
ctccagccaagcctaaccccctttaaagattgcgctatcatggcgtttagaaaccattct
tttaaagatagcctcatgctagaaacctgtaaaacacccaccgcttggcaaaaacccatg
cttacgaatttgaaaaacttgaatgacgctttgaatttgatcaatttaaacaaagaattg
tatttgatccacaaccctagcgatttatctttgcgtcgtaaggaactcttgctttctaaa
ttagaaaactccaactcttttaaaaccttaaagattttagataaagcggatgaagtgagt
tacccaagctatagtcttaatcctcattttatagatattgtctatacctacaaccgctct
catatcaaacacatccgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system