KEGG   Helicobacter pylori SJM180: HPSJM_02935
Entry
HPSJM_02935       CDS       T01323                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00540  Lipopolysaccharide biosynthesis
hpm01100  Metabolic pathways
Module
hpm_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSJM_02935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpm01005]
    HPSJM_02935
Lipopolysaccharide biosynthesis proteins [BR:hpm01005]
 Lipid A
  HPSJM_02935
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ADO02179
UniProt: E1PZ38
LinkDB
Position
complement(580384..581406)
AA seq 340 aa
MLSCIIKPLLLKPPPYFTQLTIPKPNDALSVHASSLIGLPNDNLLSAYFSGTKEGARDVK
ISANLFDSKTNRWSEAFTILTKEELSKNVHEYIKKLGNPLLFLHDDKILLFVVGVSMGGW
ATSKIYQLESALEPIRFKFVRKLSLSPFLNLSHLIKNKPLSTTDGGFMLPLYHELATQYP
LLLKFDQQNNPRELLRPNALNHQLQPSLTPFKDCAVMAFRNHSFKDSLMLETCKTPTAWQ
KPMLTNLKNLNDALNLINLNKELYLIHNPSDLSLRRKELWLSKLENPNSFKTLKVLDKAN
EVSYPSYSLNPHFIDIVYTYNRSHIKHIRFNMAYLNSLLK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgctttcatgcataatcaaacccttgttactcaaaccccccccctatttcacgcaactc
actatccctaaaccaaatgacgctttaagcgtgcatgcgagctctttaatcggcttgcct
aatgataatcttttgagcgcttattttagcggcactaaagaaggggcaagggatgtgaaa
atcagcgcaaatctttttgacagcaaaactaatcgctggagcgaagccttcactatttta
accaaagaagaactttccaaaaacgtgcatgaatacatcaaaaaattgggtaaccccttg
ctttttttgcatgacgataaaatcttgttgtttgtggtaggggtgagcatgggcgggtgg
gccacttctaaaatctatcaacttgaaagcgctttagagccgattcgttttaagtttgtg
cgaaaactctctttaagcccttttttaaacttaagccatttgataaaaaataaaccctta
agcaccactgatggcggttttatgctaccgctctatcacgaattagccacccaatacccc
ttgttgttgaaatttgaccaacaaaataacccaagagagcttttaaggcctaatgcccta
aaccaccagctccaaccaagcctaaccccctttaaagactgcgccgtcatggcgtttaga
aaccattcttttaaagatagcctcatgctagaaacctgcaagacccccaccgcttggcaa
aaacccatgctcacgaatttgaaaaacttgaatgacgctttgaatttgatcaacttaaac
aaagaattgtatttgatccacaaccctagcgatttatcactgcgtcgtaaagaactttgg
ctttctaaattagaaaacccaaactcgtttaaaaccttaaaagttttggacaaagcgaat
gaagtgagttacccaagctatagccttaatccgcattttatagatattgtctatacttac
aaccgctctcacatcaaacacatccgtttcaatatggcttatttaaattcccttctcaag
taa

DBGET integrated database retrieval system