KEGG   Helicobacter pylori 35A: HMPREF4655_21021
Entry
HMPREF4655_21021  CDS       T01892                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00540  Lipopolysaccharide biosynthesis
hpo01100  Metabolic pathways
Module
hpo_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HMPREF4655_21021
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpo01005]
    HMPREF4655_21021
Lipopolysaccharide biosynthesis proteins [BR:hpo01005]
 Lipid A
  HMPREF4655_21021
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ADU41116
UniProt: E6S264
LinkDB
Position
1007547..1008665
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKRQTPPYAFMHNQTLSTESPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFVILTKEELSHY
SHEYIKKLGNPLLFLHDNKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVRKLSLSPF
LNLSHLIRNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNYQLQPSL
TPFKDCALMAFRNHSLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgcctttttcgtggggctttttatcgtt
ttatttttaatgataatgaagcgccaaacccccccttatgcttttatgcacaatcaaacc
ctttcaaccgaaagccccccctatttcacacaactcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcgttattttaaccaaagaagagctttctcattat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatgacaataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcattttaaatttgtgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataaggaacaagcctttaaacaccactgatggcgggtttatg
ctaccgctttatcacgaattagccacccaataccccttattgttaaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaactatcagctccagccaagccta
accccctttaaagactgcgctctcatggcgtttagaaaccattctttaaaagatagtctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtttatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system