KEGG   Helicobacter pylori P12: HPP12_0586
Entry
HPP12_0586        CDS       T00786                                 
Name
(GenBank) neuraminidase
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00540  Lipopolysaccharide biosynthesis
hpp01100  Metabolic pathways
Module
hpp_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPP12_0586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpp01005]
    HPP12_0586
Lipopolysaccharide biosynthesis proteins [BR:hpp01005]
 Lipid A
  HPP12_0586
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ACJ07740
UniProt: B6JLG2
LinkDB
Position
complement(615856..616974)
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIAMKHQTPPYAFTHNQTLVTETPPYFTQFTIPKPNGA
LSVHASALISLPNDNLLSAYFSGTKEGAKDVKISANLFDGKINRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHEDKILLFVVGVSMGGWATSKIYQLESTLEPIHFKFVQKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDQQNNSRELLRPNTLNHQLQPSL
TPFKNCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDLSLRRKELLLSKLENPNSFKILKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaagcatgccgccttttttgtggggctttttattgtt
ttatttttaattgcaatgaagcaccaaacccccccctatgctttcacgcataatcaaacc
cttgttactgaaacccccccctatttcacacaattcactatccctaaaccaaatggcgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaaaagatgtgaaaatcagcgcgaatctttttgatggc
aagattaatcgctggagcgaagccttcattattttaaccaaagaagagctttctcattat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatgaagataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctaccaactt
gaaagcactttagagccaattcactttaagtttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataaacctttaaacaccactgatggcgggtttatg
ctaccactctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataactcaagagagcttttaaggcctaataccctaaaccaccagctccagccaagccta
accccctttaaaaattgcgccatcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacacccaccgcttggcaaaaacccatgctcacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgatttatctttgcgtcgtaaggaactcttgctttctaaattagaaaacccaaac
tcgtttaaaatcttaaaagttttagacaaagccaatgaagtgagttacccaagctatagc
cttaatcctcattttatagatattgtctatacctataaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaaatcccttctcaagtaa

DBGET integrated database retrieval system