KEGG   Helicobacter pylori Shi470: HPSH_03975
Entry
HPSH_03975        CDS       T00742                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00540  Lipopolysaccharide biosynthesis
hps01100  Metabolic pathways
Module
hps_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hps00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSH_03975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hps01005]
    HPSH_03975
Lipopolysaccharide biosynthesis proteins [BR:hps01005]
 Lipid A
  HPSH_03975
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ACD48230
LinkDB
Position
776579..777697
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFMHNQTLSTKNPPYFTQLTIPKPDGA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQFESALEPIHFKFVQKLSLSPF
LNLSHLIKNKPLSTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSLKDCLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMTYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttatgcacaatcaaacc
ctttcaaccaaaaacccaccctatttcacacagctcactatccctaaaccagatggtgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagtgaagccttcatcattttaaccaaagaagagctttctcattat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaattt
gaaagcgctttagagccgattcattttaagtttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaagcaccactgatggagggtttatg
ctaccactctatcacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagcttcagccaagccta
accccctttaaagactgtgctgtcatggcgtttagaaaccattctttaaaagattgcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatctttgcgccgtaaagaactcttactttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatgacctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system