KEGG   Helicobacter pylori 2018: hp2018_0569
Entry
hp2018_0569       CDS       T01914                                 
Name
(GenBank) BNR/Asp-box repeat protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpw  Helicobacter pylori 2018
Pathway
hpw00540  Lipopolysaccharide biosynthesis
hpw01100  Metabolic pathways
Module
hpw_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    hp2018_0569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpw01005]
    hp2018_0569
Lipopolysaccharide biosynthesis proteins [BR:hpw01005]
 Lipid A
  hp2018_0569
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: ADZ51263
LinkDB
Position
complement(561273..562391)
AA seq 372 aa
MESSRNRLKHAAFFVGLFIVSFLIIMKRQTPPYAFTHNQTLVTQNPPYFTQLTIPKPNDA
LSVHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNCWSEAFILLTKEELSHY
SHEYIKKLGNPLLFLHDNKILLFVVGVSMGGWATSKIYQLESALEPIRFKFAQKLSLSPF
LNLSHLVRNKPLNTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNTLNHQLQPSL
TPFKDCAVMAFRNHSLKDNLILETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDLSLRRKELWLSKLENSNSFKVLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLNSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaatcttcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
tcatttttaattataatgaagcgccaaacccccccctatgctttcacgcataatcaaacc
cttgttactcaaaaccccccctatttcacgcagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagctctttaatcagcttgcctaacgacaatcttttaagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagactaattgctggagcgaagccttcattcttttaaccaaagaagagctttctcattat
tcgcatgaatacatcaaaaaattgggtaaccccttgcttttcttgcatgataataaaatc
ttgttgtttgtggtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgcgcaaaaactctctttaagccctttt
ttaaacttgagccatttagtaaggaataagcctttaaacaccactgatggcgggtttatg
ctaccactctatcacgaattagccacccaataccccctattattgaaatttgaccaacaa
aataacccaagagagcttttaaggcctaataccctaaaccaccagctccaaccaagctta
accccctttaaagactgcgctgtcatggcgtttagaaaccattctcttaaagataatctc
atactagaaacctgcaagacccctaccgcttggcaaaaacccatgctcacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgatttatcactgcgtcgtaaagaactttggctttctaaattagaaaactccaac
tcgtttaaagttttaaaagttttagacaaagccaatgaagtgagttacccaagctatagt
cttaatccgcattttatagatattgtttatacctataaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaattcccttctcaagtga

DBGET integrated database retrieval system