KEGG   Helicobacter pylori 83: HMPREF0462_0836
Entry
HMPREF0462_0836   CDS       T01915                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpx  Helicobacter pylori 83
Pathway
hpx00540  Lipopolysaccharide biosynthesis
hpx01100  Metabolic pathways
Module
hpx_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HMPREF0462_0836
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpx01005]
    HMPREF0462_0836
Lipopolysaccharide biosynthesis proteins [BR:hpx01005]
 Lipid A
  HMPREF0462_0836
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AEE70441
UniProt: F4D616
LinkDB
Position
827244..828320
AA seq 358 aa
MGLFIVLLLMIMKRQTPPYAFLHNQTLSTKSPPYFTQLTIPKPNDALSVHASALISLPND
NLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFVILTKEELSYYSHEYIKKLGNPLLF
LHDNKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVQKLSLSPFLNLSHLIRNKPLST
TDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSLTPFKDCALMTFRNH
SLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNQELYLIHNPSDSSLRRKELLLS
KLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHIRFNMAYLKSLLK
NT seq 1077 nt   +upstreamnt  +downstreamnt
gtggggctttttatcgttttacttttaatgataatgaagcgccaaacccccccctatgct
tttttacacaatcaaaccctttcaaccaaaagccccccctatttcacacaactcactatc
cctaaaccaaatgacgctttaagcgtgcatgcgagcgctttaatcagcttgcctaacgat
aaccttttgagcgcttattttagcggcactaaagaaggggcaagggatgtgaaaatcagc
gcgaatctttttgacagcaagatcaatcgctggagcgaagccttcgttattttaaccaaa
gaagagctttcttattattcgcatgaatatatcaaaaaactaggtaaccccttgcttttt
ttgcatgacaataaaattttgttgtttgtcgtaggggtgagtatgggcgggtgggccact
tctaaaatctatcaacttgaaagcgctttagagccgattcattttaaatttgtgcaaaaa
ctctctttaagcccttttttaaacttaagccatttgataaggaacaagcctttaagcacc
actgatggcgggtttatgctaccactctatcacgaattagccacccaataccccttattg
ttaaaatttgacaaacacaataacccaagagagcttttaaggcctaatgccctaaaccac
cagctccagccaagcctaaccccctttaaagactgcgctctcatgacgtttagaaaccat
tctttaaaagatagcctcatgctagaaacctgtaaaacccccaccgcttggcaaaaaccc
atgcttacgaatttgaaaaacttgaatgacgctttgaatttgatcaatttaaaccaagaa
ttatatttgatccacaaccctagcgattcatctttgcgtcgtaaagaactcttgctttct
aaattagaaaactcaaactcttttaaaaccttaaaaattttagataaagcgaatgaagtg
agttacccaagctatagtcttaattctcattttatagatattgtctatacctacaaccgc
tctcatatcaaacatatccgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system