KEGG   Helicobacter pylori Aklavik117: HPAKL117_02740
Entry
HPAKL117_02740    CDS       T02352                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpya  Helicobacter pylori Aklavik117
Pathway
hpya00540  Lipopolysaccharide biosynthesis
hpya01100  Metabolic pathways
Module
hpya_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpya00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPAKL117_02740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpya01005]
    HPAKL117_02740
Lipopolysaccharide biosynthesis proteins [BR:hpya01005]
 Lipid A
  HPAKL117_02740
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFX90961
UniProt: K7YBA0
LinkDB
Position
complement(565617..566735)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIMMKRQTPPYAFLHNKTLSTKNPPYFTQFTIPKPDDA
LSVHASVLINLPNDNLLSAYFSGTKEGARDVKISANLFDGKINRWSEAFVILTKEELSFY
SHEYIKKLGNPLLFLHGDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVRKLSLSPF
LNLSHLIRNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSFKDSLMLETCKTPTTWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaattatgatgaagcgccaaacccccccctatgcttttttgcacaacaaaacc
ctttcaaccaaaaaccccccctatttcacacaattcactatccctaaaccagatgacgct
ttaagcgtgcatgcgagcgttttaatcaacttgcctaacgataatcttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcaaatctctttgatggc
aagatcaatcgctggagtgaagccttcgttattttaaccaaagaagagctttctttttat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatggcgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcactttaaatttgtgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataagaaataagcctttaaacaccaccgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagactgtgctgtcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccacttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagccaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system