KEGG   Helicobacter pylori oki102: HPOKI102_04115
Entry
HPOKI102_04115    CDS       T03182                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyb  Helicobacter pylori oki102
Pathway
hpyb00540  Lipopolysaccharide biosynthesis
hpyb01100  Metabolic pathways
Module
hpyb_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpyb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPOKI102_04115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyb01005]
    HPOKI102_04115
Lipopolysaccharide biosynthesis proteins [BR:hpyb01005]
 Lipid A
  HPOKI102_04115
SSDB
Motif
Pfam: BNR_2 DUF3741 OppC_N
Other DBs
NCBI-ProteinID: AHN34782
LinkDB
Position
836557..837675
AA seq 372 aa
MEPSRNRLKNTAFFVGLFIVLFLIAMKRQTPPYTFVHNQTLSTESPPYFTQLTIPKPNDA
LSVHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFNNKTNRWSEAFILLTKEELSKN
AHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVRKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaaaaacaccgccttttttgtggggctttttatcgtt
ttatttttaattgcaatgaagcgccaaacccccccctatacttttgtgcacaatcaaacc
ctttcaactgaaagccccccctatttcacacagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagctctttaatcagcttgcctaacgataacctcttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagtgcgaatctttttaataac
aagactaatcgctggagtgaagccttcattcttttaaccaaagaagagctttccaaaaac
gcgcatgaatacatcaaaaaattaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcattttaaatttgtgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataacccaagagagcttttaaggcctaatgccctaaaccaccagcttcagccaagccta
accccctttaaagattgcgctatcatggcgtttagaaaccattctttaaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaacttttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system