KEGG   Helicobacter pylori oki112: HPOKI112_04145
Entry
HPOKI112_04145    CDS       T03723                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyc  Helicobacter pylori oki112
Pathway
hpyc00540  Lipopolysaccharide biosynthesis
hpyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpyc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPOKI112_04145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyc01005]
    HPOKI112_04145
Lipopolysaccharide biosynthesis proteins [BR:hpyc01005]
 Lipid A
  HPOKI112_04145
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AHN36259
UniProt: X2HSU5
LinkDB
Position
843119..844237
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKRQTPPYAFVHNQTLSTKSPPYFTQLTIPKPNDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFVILTKEELSFY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFVQKLSLSPF
LNLSHLIRNKPLSTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNALNHKLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPTLTNLKNLNDALNLINLNKELYLIHN
PSDLSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaatgataatgaagcgccaaacccccccctatgcttttgtgcacaatcaaacc
ctttcaaccaaaagccccccctatttcacacagctcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgatagc
aagatcaatcgctggagcgaagccttcgttattttaaccaaagaagagctttctttttat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgttgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaaatttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaggaataagcctttaagcaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataacccaagagagcttttaaggcctaatgccctaaaccacaagctccagccaagccta
accccctttaaagattgcgctatcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccactgcttggcaaaaacccacgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgatttatcactgcgccgtaaagaactcctgctttctaaattagaaaactccaac
tcgtttaaaaccttaaagattttagataaagcgaatgaagtgagttacccaagctatagt
cttaatcctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system