KEGG   Helicobacter pylori oki673: HPOKI673_02950
Entry
HPOKI673_02950    CDS       T03727                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyg  Helicobacter pylori oki673
Pathway
hpyg00540  Lipopolysaccharide biosynthesis
hpyg01100  Metabolic pathways
Module
hpyg_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpyg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPOKI673_02950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyg01005]
    HPOKI673_02950
Lipopolysaccharide biosynthesis proteins [BR:hpyg01005]
 Lipid A
  HPOKI673_02950
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AHN41814
UniProt: X2I8K6
LinkDB
Position
complement(571647..572765)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFLHNQTLSTKSPPYFTQLTIPKPDDA
LSVHASALISLPNDKLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFILLTKEELSYY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVQKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNQELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccaaaagccccccctatttcactcagctcactatccctaaaccagatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataagcttttgagcgcttat
tttagtggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcattcttttaaccaaagaagagctttcttattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtgggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcattttaaatttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcggatttatg
ctaccgctttaccacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccaaccaagccta
accccctttaaagactgcgcagtcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaaccaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcgaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctataaccgctctcatatcaaacatatt
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system