KEGG   Helicobacter pylori oki828: HPOKI828_02955
Entry
HPOKI828_02955    CDS       T03728                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hpyh  Helicobacter pylori oki828
Pathway
hpyh00540  Lipopolysaccharide biosynthesis
hpyh01100  Metabolic pathways
Module
hpyh_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hpyh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPOKI828_02955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hpyh01005]
    HPOKI828_02955
Lipopolysaccharide biosynthesis proteins [BR:hpyh01005]
 Lipid A
  HPOKI828_02955
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AHN43254
LinkDB
Position
complement(573807..574925)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFLHNQTLSTKSPPYFTQLTIPKPDDA
LSVHASALISLPNDKLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFILLTKEELSYY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVQKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNQELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttttgcacaatcaaacc
ctttcaaccaaaagccccccctatttcactcagctcactatccctaaaccagatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataagcttttgagcgcttat
tttagtggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcgaagccttcattcttttaaccaaagaagagctttcttattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtgggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcattttaaatttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcggatttatg
ctaccgctttaccacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccaaccaagccta
accccctttaaagactgcgcagtcatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaaccaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaactcttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcgaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctataaccgctctcatatcaaacatatt
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system